Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g58.t1
Gene name
Locationscaffold_01:163497..167890
Strand-
Gene length (bp)4393
Transcript length (bp)4236
Coding sequence length (bp)4236
Protein length (aa) 1412

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14633 SH2_2 SH2 domain 3.0E-88 1191 1400
PF14641 HTH_44 Helix-turn-helix DNA-binding domain of SPT6 1.9E-35 283 406
PF14635 HHH_7 Helix-hairpin-helix motif 7.2E-31 867 974
PF14639 YqgF Holliday-junction resolvase-like of SPT6 4.1E-27 703 865
PF14632 SPT6_acidic Acidic N-terminal SPT6 2.3E-17 40 122
PF17674 HHH_9 HHH domain 4.3E-06 983 1032
PF00017 SH2 SH2 domain 9.3E-05 1226 1303

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-turn-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup4822
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g5420.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g7364.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g6540.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g2308.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g3923.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g3921.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g8134.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g7234.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g5545.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g4246.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g6593.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g3453.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g5276.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g8006.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g9432.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g8704.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g5393.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g2681.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g58.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g109.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g7868.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g8826.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g3875.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g9154.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g8809.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g7766.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g6366.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g261.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g1682.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g8073.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g4554.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g6012.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g2489.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g6871.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g58.t1
MSLRDLIEGEAVMDDDDEEVADDYDAEGRQGAGAANHYNDSSEEEDEEEDDEEAARAVREGFIVDEDEEDERAAR
KHRKRPRAAREEEHLDEEDLELIGHGPSQHRGPATDSKFKRLKRGKDRESYQQSHGVDDIFNSDEEEEAQQYARP
GQRRGLRDEMDDFIEEDTFSDDEAQRERDDLGVAPASRVNKTGLIPTDTSGLDENALEDMRAAFGDGTEYDFALQ
MEDQEDADKQTEERHLDLKDVFEPSELAERMLTEDDNEIRLLDEPERHQVARKPYKHVTLTEDQFREEAVWISNL
MLLKKRMDPELREPFQRSVAKMLEFLITDDWEVPFIFQHRKDYMIHAVKDMANGADPDDESAKYSIRAEKLLNMT
DLWDIFDHDLKFRALIDKRGTIKKTYDNLQSLFNVNDSNVEDQLIAATSMEELQDVQDYIHFQYSSQLRDLNQVN
GDATGETQRRKATGRSFFERVRNGKAYGFVRAFGITADAFAQNASKEGRRQYTEDPTEQPEDLADQFVDNDFSNS
SHVLKAAKSMFAEELAVSPKMRKVIRQAYYMNGVVDCFRTEKGLRRIDEQHPYAEFKYLRNQQLSDIARRPEMFL
RMLKAEEEGLVDVRVRFENFDQFRKRLYADIESDNYSELADAWNRVRREVLDLALGKLEKLINRSVKENIRQECE
NHVAKECREAFSQRLDQAPYKPKGMVLGTVPRVLTLSTGSGQLGRDPIHWAYTEEDGRVLENGKFFDLSVGDESR
DIADGENLAAFLDLMDRRRPDVIGVSGMTPETRRLYKLLSEIVEQKDIRGASYTNEHDEEISDPLEVVIVNDEVA
RLYHNSPRARSDNPGFGPLTHYCVALGRYLQSPLKEYASLGRDVVSIQFKPGQQLVSQDLLLKQLETALVDMVNL
VGVDLNEAVADTATANLLPYVCGLGPRKAAHLLKIVNMNGGVVNNRVELLGVNATYPAMGVKVWNNCASFVYIDF
ENADPDADPLDNTRVHPEDYDIARKMAADALELDEEDIKAETDENGTGAIMRKLFREEAQDRVNDLILEEYAEQL
EKNLNQRKRATLETIRAELQQPYEELRKHYVFLSTDDIFTMLTGETPDSLTPGMVVPIAIKRVFEDHIEAKLDCG
VDVLVAETELGVPYEIPVRNVYQVHQTVPAKILFLNRKGFSCNVSLREDQVSHPSRRNQDHGFGDWDEQQEKADK
ESLQEKTQRGGQAMRVIKHPLFRPFNSTQAEEFLGSQSPGDVVIRPSSRGPDHLAVTWKVAQGVYQHIDVLELDK
ENEFSVGRVLKVGGRYTYSDLDDLIVNHVKAMAKKVGEMVFHEKFQEGSKAETDQWLDTYTKANPRRSAYAFCIN
PKYPGYFYLCFKAGEHARLQNWPVKVIPQGYELQKNPYPDMNALCNGFKLMFSNMSKGNRR*
Coding >Pro_DTO070G2_2|g58.t1
ATGAGCCTTCGCGACCTAATCGAGGGTGAGGCAGTTATGGATGACGACGATGAGGAAGTTGCCGACGACTATGAT
GCTGAGGGCCGCCAGGGCGCAGGTGCCGCCAATCACTACAATGACTCGAGCGAGGAGGAAGACGAAGAAGAAGAT
GACGAGGAGGCTGCTCGCGCCGTCCGTGAAGGTTTCATTGTTGATGAAGACGAAGAAGACGAGCGTGCCGCCCGC
AAACACCGGAAACGTCCACGCGCTGCTCGCGAAGAAGAGCACCTTGATGAAGAAGATCTGGAACTCATTGGACAT
GGCCCAAGTCAGCATCGTGGACCAGCTACTGATTCAAAGTTTAAGCGCCTGAAGCGAGGCAAAGATCGCGAAAGC
TACCAACAGTCTCACGGCGTTGACGATATTTTCAACTCGGACGAAGAGGAGGAAGCGCAACAATATGCTAGACCA
GGCCAGCGTCGTGGTCTGCGCGATGAAATGGACGACTTTATTGAAGAAGATACCTTCTCTGACGATGAGGCTCAG
CGTGAACGGGATGACCTTGGGGTTGCGCCTGCCTCCAGAGTCAACAAGACCGGCTTGATTCCGACTGACACCTCG
GGCTTGGATGAAAATGCACTTGAGGATATGCGCGCTGCATTTGGTGATGGCACAGAGTACGATTTCGCACTGCAA
ATGGAAGACCAAGAGGACGCCGACAAACAAACCGAAGAACGCCACCTAGATTTGAAGGACGTCTTTGAACCATCC
GAGCTGGCTGAAAGAATGTTGACGGAGGACGATAACGAAATTCGTCTCCTCGATGAACCCGAACGCCATCAGGTT
GCTCGCAAGCCCTATAAACATGTGACATTGACCGAGGATCAATTCCGGGAGGAGGCAGTCTGGATTTCGAACTTG
ATGCTACTAAAGAAGCGCATGGATCCCGAACTGCGCGAACCATTCCAGCGCTCCGTTGCTAAGATGTTAGAATTC
CTGATCACGGACGATTGGGAGGTACCCTTCATTTTTCAGCATCGCAAAGACTACATGATTCATGCTGTCAAAGAT
ATGGCCAATGGCGCCGATCCCGACGACGAGTCCGCCAAATACAGCATCCGGGCCGAGAAACTCCTCAATATGACA
GATTTATGGGATATCTTCGACCATGATCTCAAATTCCGGGCTTTGATCGACAAGCGTGGTACAATTAAAAAGACA
TACGACAATCTGCAAAGCCTCTTCAATGTGAATGATTCCAACGTCGAGGATCAACTTATTGCGGCCACGAGCATG
GAGGAGCTTCAAGATGTGCAGGACTATATCCATTTCCAGTACTCCTCACAGCTACGTGATCTCAACCAGGTCAAT
GGCGATGCTACTGGAGAAACACAACGCCGAAAAGCCACCGGAAGATCTTTCTTTGAGCGTGTTCGGAACGGCAAG
GCCTATGGCTTCGTGCGTGCTTTTGGTATCACTGCAGATGCGTTTGCTCAGAACGCCTCCAAGGAAGGTCGCCGG
CAATACACCGAAGATCCCACCGAGCAGCCTGAAGATTTGGCAGATCAGTTTGTCGACAATGACTTTTCTAACAGT
TCGCATGTCCTCAAAGCTGCTAAGTCAATGTTCGCCGAAGAGCTTGCTGTCAGCCCTAAAATGCGCAAGGTGATC
CGTCAGGCATACTACATGAATGGAGTCGTGGATTGCTTCCGCACAGAGAAAGGACTTCGCCGGATCGATGAGCAG
CATCCGTATGCTGAATTCAAATACCTGCGGAACCAGCAGCTAAGCGATATTGCCCGTCGCCCGGAGATGTTCTTG
CGCATGCTCAAGGCCGAGGAAGAAGGACTCGTTGATGTCCGGGTGAGGTTTGAGAACTTTGACCAGTTCCGCAAA
CGTCTCTACGCCGATATCGAGTCAGACAACTACAGTGAGCTTGCTGATGCTTGGAACCGTGTTCGCCGTGAGGTG
CTGGATTTGGCTTTGGGCAAACTGGAGAAGTTGATCAATCGCAGTGTGAAGGAAAATATTCGACAGGAATGTGAG
AACCATGTGGCCAAGGAGTGCCGCGAAGCGTTCTCACAACGTCTCGACCAGGCCCCTTACAAACCCAAGGGCATG
GTTCTGGGCACAGTGCCCCGTGTTCTCACTCTCTCCACCGGATCTGGTCAGCTGGGCCGGGACCCCATTCACTGG
GCTTACACAGAAGAAGATGGCCGTGTCTTGGAGAATGGCAAATTCTTTGATCTTTCGGTAGGAGATGAGAGCCGT
GACATTGCAGATGGTGAGAACCTAGCCGCATTTTTGGATCTGATGGATCGTCGTCGACCAGATGTCATTGGTGTT
TCAGGCATGACGCCAGAGACGCGCCGCCTGTACAAGCTTCTATCCGAAATAGTCGAACAAAAAGACATACGTGGT
GCATCCTACACAAATGAGCACGATGAGGAGATCAGCGACCCATTAGAGGTGGTCATTGTCAATGATGAGGTTGCC
CGGTTGTACCACAACAGCCCTCGCGCCAGAAGCGACAATCCAGGCTTTGGACCTCTAACCCATTACTGTGTGGCT
CTAGGCCGGTACTTGCAGAGCCCGCTCAAGGAATATGCATCCTTAGGCCGTGACGTTGTCTCCATCCAGTTCAAA
CCAGGCCAGCAACTAGTCTCCCAGGACCTGCTTCTCAAGCAGCTGGAAACCGCACTGGTGGACATGGTCAACTTA
GTCGGCGTTGACCTCAACGAGGCAGTGGCGGACACGGCGACAGCCAATCTCTTGCCGTATGTCTGCGGTCTTGGT
CCCCGAAAGGCGGCTCACTTGCTCAAGATTGTCAATATGAACGGCGGAGTCGTTAACAACCGGGTAGAATTGCTT
GGTGTCAACGCAACATACCCGGCTATGGGTGTCAAGGTTTGGAACAACTGTGCTAGTTTCGTCTATATTGACTTC
GAGAATGCTGATCCCGATGCTGATCCGCTGGATAACACCCGTGTGCATCCCGAAGACTACGATATTGCGCGCAAG
ATGGCCGCCGACGCACTTGAGCTGGACGAGGAAGATATCAAGGCCGAAACTGACGAGAACGGCACTGGTGCCATC
ATGCGGAAGCTGTTCCGGGAAGAGGCACAGGACCGTGTCAACGATCTTATTTTGGAGGAGTACGCAGAGCAGCTT
GAGAAAAACCTCAACCAGCGCAAGCGTGCCACACTCGAGACGATCCGAGCCGAGTTACAACAACCCTACGAGGAA
TTGCGCAAGCACTATGTCTTCCTCAGCACCGATGATATTTTCACAATGCTCACTGGCGAGACGCCCGACTCTTTA
ACACCTGGTATGGTGGTGCCCATTGCTATCAAGCGGGTATTTGAGGATCACATTGAGGCCAAATTGGATTGCGGA
GTTGATGTACTCGTGGCCGAGACCGAACTCGGCGTTCCCTACGAAATCCCTGTACGCAATGTATACCAAGTCCAC
CAAACTGTCCCGGCCAAGATTCTGTTCTTGAACCGCAAGGGTTTCTCTTGCAACGTCTCTCTACGTGAGGATCAG
GTCAGCCATCCATCTCGTCGGAACCAGGATCATGGCTTCGGCGATTGGGACGAACAGCAAGAGAAAGCCGACAAG
GAGTCGCTGCAAGAAAAGACGCAGCGTGGCGGCCAAGCCATGCGTGTCATCAAGCACCCGCTTTTCCGGCCGTTC
AACTCTACCCAGGCCGAGGAGTTCCTAGGTTCTCAAAGCCCAGGCGACGTTGTTATTCGCCCGTCCTCCCGAGGT
CCCGATCACTTAGCTGTCACCTGGAAGGTGGCGCAAGGTGTGTACCAGCACATCGATGTTCTCGAGCTGGACAAA
GAGAACGAGTTCTCTGTCGGCCGTGTCCTCAAGGTCGGTGGTCGGTATACTTATAGTGACCTGGACGACCTGATC
GTCAATCACGTCAAAGCGATGGCCAAGAAGGTGGGCGAGATGGTATTCCACGAGAAATTCCAAGAAGGCAGCAAG
GCCGAGACAGATCAATGGCTCGATACTTATACCAAGGCCAACCCTCGCCGCTCGGCATATGCATTCTGCATCAAC
CCCAAATACCCCGGTTACTTTTATCTTTGCTTCAAGGCAGGCGAGCATGCACGACTTCAAAACTGGCCGGTCAAG
GTGATTCCCCAGGGCTACGAACTGCAGAAGAACCCCTACCCGGACATGAACGCTCTATGCAACGGCTTTAAGCTG
ATGTTTAGCAACATGAGCAAGGGCAACCGGAGATGA
Transcript >Pro_DTO070G2_2|g58.t1
ATGAGCCTTCGCGACCTAATCGAGGGTGAGGCAGTTATGGATGACGACGATGAGGAAGTTGCCGACGACTATGAT
GCTGAGGGCCGCCAGGGCGCAGGTGCCGCCAATCACTACAATGACTCGAGCGAGGAGGAAGACGAAGAAGAAGAT
GACGAGGAGGCTGCTCGCGCCGTCCGTGAAGGTTTCATTGTTGATGAAGACGAAGAAGACGAGCGTGCCGCCCGC
AAACACCGGAAACGTCCACGCGCTGCTCGCGAAGAAGAGCACCTTGATGAAGAAGATCTGGAACTCATTGGACAT
GGCCCAAGTCAGCATCGTGGACCAGCTACTGATTCAAAGTTTAAGCGCCTGAAGCGAGGCAAAGATCGCGAAAGC
TACCAACAGTCTCACGGCGTTGACGATATTTTCAACTCGGACGAAGAGGAGGAAGCGCAACAATATGCTAGACCA
GGCCAGCGTCGTGGTCTGCGCGATGAAATGGACGACTTTATTGAAGAAGATACCTTCTCTGACGATGAGGCTCAG
CGTGAACGGGATGACCTTGGGGTTGCGCCTGCCTCCAGAGTCAACAAGACCGGCTTGATTCCGACTGACACCTCG
GGCTTGGATGAAAATGCACTTGAGGATATGCGCGCTGCATTTGGTGATGGCACAGAGTACGATTTCGCACTGCAA
ATGGAAGACCAAGAGGACGCCGACAAACAAACCGAAGAACGCCACCTAGATTTGAAGGACGTCTTTGAACCATCC
GAGCTGGCTGAAAGAATGTTGACGGAGGACGATAACGAAATTCGTCTCCTCGATGAACCCGAACGCCATCAGGTT
GCTCGCAAGCCCTATAAACATGTGACATTGACCGAGGATCAATTCCGGGAGGAGGCAGTCTGGATTTCGAACTTG
ATGCTACTAAAGAAGCGCATGGATCCCGAACTGCGCGAACCATTCCAGCGCTCCGTTGCTAAGATGTTAGAATTC
CTGATCACGGACGATTGGGAGGTACCCTTCATTTTTCAGCATCGCAAAGACTACATGATTCATGCTGTCAAAGAT
ATGGCCAATGGCGCCGATCCCGACGACGAGTCCGCCAAATACAGCATCCGGGCCGAGAAACTCCTCAATATGACA
GATTTATGGGATATCTTCGACCATGATCTCAAATTCCGGGCTTTGATCGACAAGCGTGGTACAATTAAAAAGACA
TACGACAATCTGCAAAGCCTCTTCAATGTGAATGATTCCAACGTCGAGGATCAACTTATTGCGGCCACGAGCATG
GAGGAGCTTCAAGATGTGCAGGACTATATCCATTTCCAGTACTCCTCACAGCTACGTGATCTCAACCAGGTCAAT
GGCGATGCTACTGGAGAAACACAACGCCGAAAAGCCACCGGAAGATCTTTCTTTGAGCGTGTTCGGAACGGCAAG
GCCTATGGCTTCGTGCGTGCTTTTGGTATCACTGCAGATGCGTTTGCTCAGAACGCCTCCAAGGAAGGTCGCCGG
CAATACACCGAAGATCCCACCGAGCAGCCTGAAGATTTGGCAGATCAGTTTGTCGACAATGACTTTTCTAACAGT
TCGCATGTCCTCAAAGCTGCTAAGTCAATGTTCGCCGAAGAGCTTGCTGTCAGCCCTAAAATGCGCAAGGTGATC
CGTCAGGCATACTACATGAATGGAGTCGTGGATTGCTTCCGCACAGAGAAAGGACTTCGCCGGATCGATGAGCAG
CATCCGTATGCTGAATTCAAATACCTGCGGAACCAGCAGCTAAGCGATATTGCCCGTCGCCCGGAGATGTTCTTG
CGCATGCTCAAGGCCGAGGAAGAAGGACTCGTTGATGTCCGGGTGAGGTTTGAGAACTTTGACCAGTTCCGCAAA
CGTCTCTACGCCGATATCGAGTCAGACAACTACAGTGAGCTTGCTGATGCTTGGAACCGTGTTCGCCGTGAGGTG
CTGGATTTGGCTTTGGGCAAACTGGAGAAGTTGATCAATCGCAGTGTGAAGGAAAATATTCGACAGGAATGTGAG
AACCATGTGGCCAAGGAGTGCCGCGAAGCGTTCTCACAACGTCTCGACCAGGCCCCTTACAAACCCAAGGGCATG
GTTCTGGGCACAGTGCCCCGTGTTCTCACTCTCTCCACCGGATCTGGTCAGCTGGGCCGGGACCCCATTCACTGG
GCTTACACAGAAGAAGATGGCCGTGTCTTGGAGAATGGCAAATTCTTTGATCTTTCGGTAGGAGATGAGAGCCGT
GACATTGCAGATGGTGAGAACCTAGCCGCATTTTTGGATCTGATGGATCGTCGTCGACCAGATGTCATTGGTGTT
TCAGGCATGACGCCAGAGACGCGCCGCCTGTACAAGCTTCTATCCGAAATAGTCGAACAAAAAGACATACGTGGT
GCATCCTACACAAATGAGCACGATGAGGAGATCAGCGACCCATTAGAGGTGGTCATTGTCAATGATGAGGTTGCC
CGGTTGTACCACAACAGCCCTCGCGCCAGAAGCGACAATCCAGGCTTTGGACCTCTAACCCATTACTGTGTGGCT
CTAGGCCGGTACTTGCAGAGCCCGCTCAAGGAATATGCATCCTTAGGCCGTGACGTTGTCTCCATCCAGTTCAAA
CCAGGCCAGCAACTAGTCTCCCAGGACCTGCTTCTCAAGCAGCTGGAAACCGCACTGGTGGACATGGTCAACTTA
GTCGGCGTTGACCTCAACGAGGCAGTGGCGGACACGGCGACAGCCAATCTCTTGCCGTATGTCTGCGGTCTTGGT
CCCCGAAAGGCGGCTCACTTGCTCAAGATTGTCAATATGAACGGCGGAGTCGTTAACAACCGGGTAGAATTGCTT
GGTGTCAACGCAACATACCCGGCTATGGGTGTCAAGGTTTGGAACAACTGTGCTAGTTTCGTCTATATTGACTTC
GAGAATGCTGATCCCGATGCTGATCCGCTGGATAACACCCGTGTGCATCCCGAAGACTACGATATTGCGCGCAAG
ATGGCCGCCGACGCACTTGAGCTGGACGAGGAAGATATCAAGGCCGAAACTGACGAGAACGGCACTGGTGCCATC
ATGCGGAAGCTGTTCCGGGAAGAGGCACAGGACCGTGTCAACGATCTTATTTTGGAGGAGTACGCAGAGCAGCTT
GAGAAAAACCTCAACCAGCGCAAGCGTGCCACACTCGAGACGATCCGAGCCGAGTTACAACAACCCTACGAGGAA
TTGCGCAAGCACTATGTCTTCCTCAGCACCGATGATATTTTCACAATGCTCACTGGCGAGACGCCCGACTCTTTA
ACACCTGGTATGGTGGTGCCCATTGCTATCAAGCGGGTATTTGAGGATCACATTGAGGCCAAATTGGATTGCGGA
GTTGATGTACTCGTGGCCGAGACCGAACTCGGCGTTCCCTACGAAATCCCTGTACGCAATGTATACCAAGTCCAC
CAAACTGTCCCGGCCAAGATTCTGTTCTTGAACCGCAAGGGTTTCTCTTGCAACGTCTCTCTACGTGAGGATCAG
GTCAGCCATCCATCTCGTCGGAACCAGGATCATGGCTTCGGCGATTGGGACGAACAGCAAGAGAAAGCCGACAAG
GAGTCGCTGCAAGAAAAGACGCAGCGTGGCGGCCAAGCCATGCGTGTCATCAAGCACCCGCTTTTCCGGCCGTTC
AACTCTACCCAGGCCGAGGAGTTCCTAGGTTCTCAAAGCCCAGGCGACGTTGTTATTCGCCCGTCCTCCCGAGGT
CCCGATCACTTAGCTGTCACCTGGAAGGTGGCGCAAGGTGTGTACCAGCACATCGATGTTCTCGAGCTGGACAAA
GAGAACGAGTTCTCTGTCGGCCGTGTCCTCAAGGTCGGTGGTCGGTATACTTATAGTGACCTGGACGACCTGATC
GTCAATCACGTCAAAGCGATGGCCAAGAAGGTGGGCGAGATGGTATTCCACGAGAAATTCCAAGAAGGCAGCAAG
GCCGAGACAGATCAATGGCTCGATACTTATACCAAGGCCAACCCTCGCCGCTCGGCATATGCATTCTGCATCAAC
CCCAAATACCCCGGTTACTTTTATCTTTGCTTCAAGGCAGGCGAGCATGCACGACTTCAAAACTGGCCGGTCAAG
GTGATTCCCCAGGGCTACGAACTGCAGAAGAACCCCTACCCGGACATGAACGCTCTATGCAACGGCTTTAAGCTG
ATGTTTAGCAACATGAGCAAGGGCAACCGGAGATGA
Gene >Pro_DTO070G2_2|g58.t1
ATGAGCCTTCGCGACCTAATCGAGGGTGAGGCAGTTATGGATGACGACGATGAGGAAGTTGCCGACGACTATGAT
GCTGAGGGCCGCCAGGGCGCAGGTGCCGCCAATCACTACAATGACTCGAGCGAGGAGGAAGACGAAGAAGAAGAT
GACGAGGAGGCTGCTCGCGCCGTCAGTTTTCGCCTTTCACCGGGTTGTATCTCTTTGCTGACGAACTATTAGGTC
CGTGAAGGTTTCATTGTTGATGAAGACGAAGAAGACGAGCGTGCCGCCCGCAAACACCGGAAACGTCCACGCGCT
GCTCGCGAAGAAGAGCACCTTGATGAAGAAGATCTGGAACTCATTGGACATGGCCCAAGTCAGCATCGTGGACCA
GCTACTGATGTATGTAAGCCGCAGCTCATTACTTGACAAGATTCTGATGCTCTGATTTTAGTCAAAGTTTAAGCG
CCTGAAGCGAGGCAAAGATCGCGAAAGCTACCAACAGTCTCACGGCGTTGACGATATTTTCAACTCGGACGAAGA
GGAGGAAGCGCAACAATATGCTAGACCAGGCCAGCGTCGTGGTCTGCGCGATGAAATGGACGACTTTATTGAAGA
AGATACCTTCTCTGACGATGAGGCTCAGCGTGAACGGGATGACCTTGGGGTTGCGCCTGCCTCCAGAGTCAACAA
GACCGGCTTGATTCCGACTGACACCTCGGGCTTGGATGAAAATGCACTTGAGGATATGCGCGCTGCATTTGGTGA
TGGCACAGAGTACGATTTCGCACTGCAAATGGAAGACCAAGAGGACGCCGACAAACAAACCGAAGAACGCCACCT
AGATTTGAAGGACGTCTTTGAACCATCCGAGCTGGCTGAAAGAATGTTGACGGAGGACGATAACGAAATTCGTCT
CCTCGATGAACCCGAACGCCATCAGGTTGCTCGCAAGCCCTATAAACATGTGACATTGACCGAGGATCAATTCCG
GGAGGAGGCAGTCTGGATTTCGAACTTGATGCTACTAAAGAAGCGCATGGATCCCGAACTGCGCGAACCATTCCA
GCGCTCCGTTGCTAAGATGTTAGAATTCCTGATCACGGACGATTGGGAGGTACCCTTCATTTTTCAGCATCGCAA
AGACTACATGATTCATGCTGTCAAAGATATGGCCAATGGCGCCGATCCCGACGACGAGTCCGCCAAATACAGCAT
CCGGGCCGAGAAACTCCTCAATATGACAGATTTATGGGATATCTTCGACCATGATCTCAAATTCCGGGCTTTGAT
CGACAAGCGTGGTACAATTAAAAAGACATACGACAATCTGCAAAGCCTCTTCAATGTGAATGATTCCAACGTCGA
GGATCAACTTATTGCGGCCACGAGCATGGAGGAGCTTCAAGATGTGCAGGACTATATCCATTTCCAGTACTCCTC
ACAGCTACGTGATCTCAACCAGGTCAATGGCGATGCTACTGGAGAAACACAACGCCGAAAAGCCACCGGAAGATC
TTTCTTTGAGCGTGTTCGGAACGGCAAGGCCTATGGCTTCGTGCGTGCTTTTGGTATCACTGCAGATGCGTTTGC
TCAGAACGCCTCCAAGGAAGGTCGCCGGCAATACACCGAAGATCCCACCGAGCAGCCTGAAGATTTGGCAGATCA
GTTTGTCGACAATGACTTTTCTAACAGTTCGCATGTCCTCAAAGCTGCTAAGTCAATGTTCGCCGAAGAGCTTGC
TGTCAGCCCTAAAATGCGCAAGGTGATCCGTCAGGCATACTACATGAATGGAGTCGTGGATTGCTTCCGCACAGA
GAAAGGACTTCGCCGGATCGATGAGCAGCATCCGTATGCTGAATTCAAATACCTGCGGAACCAGCAGCTAAGCGA
TATTGCCCGTCGCCCGGAGATGTTCTTGCGCATGCTCAAGGCCGAGGAAGAAGGACTCGTTGATGTCCGGGTGAG
GTTTGAGAACTTTGACCAGTTCCGCAAACGTCTCTACGCCGATATCGAGTCAGACAACTACAGTGAGCTTGCTGA
TGCTTGGAACCGTGTTCGCCGTGAGGTGCTGGATTTGGCTTTGGGCAAACTGGAGAAGTTGATCAATCGCAGTGT
GAAGGAAAATATTCGACAGGAATGTGAGAACCATGTGGCCAAGGAGTGCCGCGAAGCGTTCTCACAACGTCTCGA
CCAGGCCCCTTACAAACCCAAGGGCATGGTTCTGGGCACAGTGCCCCGTGTTCTCACTCTCTCCACCGGATCTGG
TCAGCTGGGCCGGGACCCCATTCACTGGGCTTACACAGAAGAAGATGGCCGTGTCTTGGAGAATGGCAAATTCTT
TGATCTTTCGGTAGGAGATGAGAGCCGTGACATTGCAGATGGTGAGAACCTAGCCGCATTTTTGGATCTGATGGA
TCGTCGTCGACCAGATGTCATTGGTGTTTCAGGCATGACGCCAGAGACGCGCCGCCTGTACAAGCTTCTATCCGA
AATAGTCGAACAAAAAGACATACGTGGTGCATCCTACACAAATGAGCACGATGAGGAGATCAGCGACCCATTAGA
GGTGGTCATTGTCAATGATGAGGTTGCCCGGTTGTACCACAACAGCCCTCGCGCCAGAAGCGACAATCCAGGCTT
TGGACCTCTAACCCATTACTGTGTGGCTCTAGGCCGGTACTTGCAGAGCCCGCTCAAGGAATATGCATCCTTAGG
CCGTGACGTTGTCTCCATCCAGTTCAAACCAGGCCAGCAACTAGTCTCCCAGGACCTGCTTCTCAAGCAGCTGGA
AACCGCACTGGTGGACATGGTCAACTTAGTCGGCGTTGACCTCAACGAGGCAGTGGCGGACACGGCGACAGCCAA
TCTCTTGCCGTATGTCTGCGGTCTTGGTCCCCGAAAGGCGGCTCACTTGCTCAAGATTGTCAATATGAACGGCGG
AGTCGTTAACAACCGGGTAGAATTGCTTGGTGTCAACGCAACATACCCGGCTATGGGTGTCAAGGTTTGGAACAA
CTGTGCTAGTTTCGTCTATATTGACTTCGAGAATGCTGATCCCGATGCTGATCCGCTGGATAACACCCGTGTGCA
TCCCGAAGACTACGATATTGCGCGCAAGATGGCCGCCGACGCACTTGAGCTGGACGAGGAAGATATCAAGGCCGA
AACTGACGAGAACGGCACTGGTGCCATCATGCGGAAGCTGTTCCGGGAAGAGGCACAGGACCGTGTCAACGATCT
TATTTTGGAGGAGTACGCAGAGCAGCTTGAGAAAAACCTCAACCAGCGCAAGCGTGCCACACTCGAGACGATCCG
AGCCGAGTTACAACAACCCTACGAGGAATTGCGCAAGCACTATGTCTTCCTCAGCACCGATGATATTTTCACAAT
GCTCACTGGCGAGACGCCCGACTCTTTAACACCTGGTATGGTGGTGCCCATTGCTATCAAGCGGGTATTTGAGGA
TCACATTGAGGCCAAATTGGATTGCGGAGTTGATGTACTCGTGGCCGAGACCGAACTCGGCGTTCCCTACGAAAT
CCCTGTACGCAATGTATACCAAGTCCACCAAACTGTCCCGGCCAAGATTCTGTTCTTGAACCGCAAGGGTTTCTC
TTGCAACGTCTCTCTACGTGAGGATCAGGTCAGCCATCCATCTCGTCGGAACCAGGATCATGGCTTCGGCGATTG
GGACGAACAGCAAGAGAAAGCCGACAAGGAGTCGCTGCAAGAAAAGACGCAGCGTGGCGGCCAAGCCATGCGTGT
CATCAAGCACCCGCTTTTCCGGCCGTTCAACTCTACCCAGGCCGAGGAGTTCCTAGGTTCTCAAAGCCCAGGCGA
CGTTGTTATTCGCCCGTCCTCCCGAGGTCCCGATCACTTAGCTGTCACCTGGAAGGTGGCGCAAGGTGTGTACCA
GCACATCGATGTTCTCGAGCTGGACAAAGAGAACGAGTTCTCTGTCGGCCGTGTCCTCAAGGTCGGTGGTCGGTA
TACTTATAGTGACCTGGACGACCTGATCGTCAATCACGTCAAAGCGATGGCCAAGAAGGTGGGCGAGATGGTATT
CCACGAGAAATTCCAAGAAGGCAGCAAGGCCGAGACAGGTATGTTTTTGATAATTTATCCCATCTAACTAGCATC
CGACTAACATCTAATAGATCAATGGCTCGATACTTATACCAAGGCCAACCCTCGCCGCTCGGCATATGCATTCTG
CATCAACCCCAAATACCCCGGTTACTTTTATCTTTGCTTCAAGGCAGGCGAGCATGCACGACTTCAAAACTGGCC
GGTCAAGGTGATTCCCCAGGGCTACGAACTGCAGAAGAACCCCTACCCGGACATGAACGCTCTATGCAACGGCTT
TAAGCTGATGTTTAGCAACATGAGCAAGGGCAACCGGAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail