Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g5746.t1
Gene name
Locationscaffold_07:874433..877800
Strand-
Gene length (bp)3367
Transcript length (bp)3030
Coding sequence length (bp)3030
Protein length (aa) 1010

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01301 Glyco_hydro_35 Glycosyl hydrolases family 35 8.7E-100 52 387
PF10435 BetaGal_dom2 Beta-galactosidase, domain 2 5.8E-58 400 576
PF13364 BetaGal_dom4_5 Beta-galactosidase jelly roll domain 3.8E-22 693 804
PF13364 BetaGal_dom4_5 Beta-galactosidase jelly roll domain 3.9E-30 861 971
PF13363 BetaGal_dom3 Beta-galactosidase, domain 3 1.7E-23 577 659

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g5746.t1
MKLSSSWAIACLAAQAAGAAITHSLNGFSITEHPDPVKRDLLQKYVTWDDKSLFVNGERIMLFSGEIHPYRLPVP
SLWIDVFQKVKALGFNCVSFYIDWALLEGKPGQYTADGIFALEPFFDAAKEAGIYLLARPGPYINAEASGGGFPG
WLQRVNGTLRTSDEAYLEATDNYIANVAATIAKGQITNGGPVILYQPENEYSGACCGYDGFPDGAYMQYVEDQAR
NAGIVVPLISNDASAGGHNAPGTGEGAVDIYGHDSYPLGFDCANPSTWPAGNLPTYFYTTHMDQSPSTPFSLVEF
QGGAFDPWGGVGFTKCAALLNHEFERVFYKNNLSFRVAFLNLYMIFGGTNWGNLGHPGGYTSYDYGSPITESRNI
TREKYSELKLIGNFVKVSPAYLLSTPGDLTTSKYTTSSDIAVTPLLGDDNTASSFFIVRHSDYSSQGSVDYKLKV
PTSAGEVTIPQLGGSLTLSGRDSKIHVVNYDVAGTNILYSSAEVFTWTGSGKSKILVLYSGPGEHHELAVSSQSK
ASVIEGSSSNITIKQVGKAVVIGWDVSVTRRIVQVGDLKIILLDRNSAYNYWVPQLPTKGTRPGYSSQEAAASSL
IVKAGYLVRTAYLQGNDLHLTADFNATTPIEVIGAPTNAKNLIINGKKAQVKIDKNGIWSSSVVYTAPKIELPIL
KRLKWKSIDTLPEIQDSYDDSTWVPANKPTKNSVHELKTPISLLSSDYGFHTGTLLFRGHFVATGNEKTFFVQTQ
GGSAFGSSVWLNENHLGSWGGISIDSDHNRTYTLPTLKKGKSYVFTVVVDNMGLDENWIIGEEEMKNPRGILNYD
LSGRSASDISWKLTGNLGGEDYLDKVRGPLNEGGLYAERQGFHQTQPPTQSWISDSPFDGLSAPGIKFYSANFDL
NIEKGWDVPLYFNFGNTTSSPAAYRVQLYVNGYQYAKYVNNIGPQTSFPVPEGILNYQGTNYLALSLWVLESDGA
KLESLDLIHTTPVLTALKVESVDQPKYKKRQAAY*
Coding >Pro_DTO070G2_2|g5746.t1
ATGAAGCTCTCGTCTTCTTGGGCCATTGCCTGTCTGGCAGCCCAGGCCGCTGGTGCTGCTATTACCCATTCGCTA
AATGGCTTTAGTATCACCGAGCACCCGGATCCCGTTAAGCGGGATTTGCTCCAGAAATACGTCACTTGGGATGAC
AAGTCTCTCTTTGTCAATGGCGAGAGAATCATGCTATTTAGTGGTGAAATCCACCCATATCGTCTGCCTGTTCCA
TCTTTGTGGATTGATGTGTTCCAAAAGGTTAAGGCTCTAGGATTTAACTGCGTTTCATTCTATATCGACTGGGCT
CTGCTGGAAGGTAAGCCGGGTCAGTATACTGCTGATGGAATATTTGCTCTGGAGCCATTCTTCGACGCCGCCAAA
GAGGCTGGCATCTATCTTCTGGCCCGTCCTGGTCCCTACATCAATGCTGAAGCATCGGGTGGTGGTTTCCCGGGA
TGGCTTCAGCGCGTGAATGGAACTCTACGAACTAGTGATGAGGCCTACCTGGAGGCAACGGACAACTACATTGCC
AATGTTGCCGCAACCATCGCGAAGGGTCAAATCACCAATGGAGGACCTGTCATTCTTTACCAACCCGAGAACGAG
TACAGTGGCGCTTGCTGTGGATACGACGGGTTTCCAGACGGTGCCTATATGCAATACGTGGAGGATCAGGCTCGG
AATGCTGGAATTGTCGTGCCTCTTATTAGCAACGATGCCTCAGCTGGTGGCCACAATGCCCCTGGAACTGGCGAA
GGGGCTGTGGATATCTATGGCCACGACAGCTACCCTCTCGGCTTTGACTGCGCAAACCCTTCTACTTGGCCAGCG
GGTAATCTGCCCACTTATTTCTATACCACACACATGGACCAGAGCCCTTCGACCCCATTCTCTCTAGTTGAGTTT
CAAGGTGGTGCCTTTGATCCCTGGGGAGGTGTTGGGTTCACGAAATGTGCTGCTCTCCTGAACCATGAGTTCGAG
AGAGTGTTTTATAAGAACAATCTCAGCTTCCGAGTTGCATTCCTCAACCTATACATGATCTTTGGTGGTACGAAT
TGGGGAAATCTGGGCCACCCCGGTGGATACACATCCTATGATTATGGTTCTCCGATTACTGAATCTCGAAACATC
ACCCGGGAGAAGTACAGCGAGCTGAAGCTGATTGGTAACTTTGTCAAAGTCTCACCGGCCTACCTTCTCTCAACA
CCAGGAGACTTGACCACTTCCAAGTACACAACCTCGTCTGATATAGCCGTGACTCCTCTGCTAGGAGACGACAAC
ACGGCTTCGTCCTTCTTCATCGTTCGACACTCCGACTACTCGAGCCAAGGGTCCGTCGACTATAAGCTCAAGGTT
CCTACTAGTGCCGGTGAAGTGACCATTCCCCAGCTTGGCGGGAGCCTCACTCTCAGCGGCCGTGATTCCAAGATT
CATGTCGTTAACTATGATGTGGCGGGCACCAACATCCTCTACTCCTCTGCTGAGGTGTTTACCTGGACGGGGTCT
GGTAAGTCCAAGATTCTTGTCTTGTACAGCGGCCCCGGCGAGCATCACGAGCTGGCTGTCTCTTCCCAGTCGAAG
GCTTCGGTTATTGAAGGCTCGTCGTCGAACATCACCATTAAGCAGGTGGGTAAGGCGGTTGTTATCGGTTGGGAC
GTCTCAGTCACTCGCCGTATTGTGCAAGTGGGTGATCTGAAGATAATTCTTCTGGATCGGAACTCTGCCTACAAC
TACTGGGTCCCTCAGCTCCCAACCAAGGGAACACGCCCTGGTTATAGTTCCCAAGAGGCAGCCGCCTCGTCTCTC
ATCGTCAAGGCTGGTTACCTCGTGCGGACTGCTTATCTGCAGGGCAATGACCTTCATCTCACTGCTGATTTCAAC
GCCACGACCCCGATTGAGGTAATTGGCGCTCCGACCAATGCCAAGAACCTGATTATCAACGGGAAGAAAGCGCAG
GTCAAGATCGACAAGAACGGAATCTGGTCCAGCAGCGTCGTCTATACCGCACCGAAGATCGAGCTTCCTATTCTG
AAGAGGCTAAAGTGGAAGTCTATTGATACTCTACCCGAGATTCAAGACTCTTACGATGATTCCACATGGGTTCCA
GCAAACAAACCCACCAAAAATAGCGTCCATGAACTCAAGACTCCTATCTCGCTACTCTCCTCTGACTACGGATTC
CACACCGGAACCCTCCTCTTCCGGGGCCACTTCGTCGCAACCGGTAACGAGAAAACTTTCTTCGTGCAGACTCAA
GGGGGTAGCGCATTCGGCAGCTCAGTATGGTTGAACGAGAACCACCTAGGATCATGGGGTGGAATATCCATTGAC
AGCGACCACAACAGAACCTACACACTACCAACTCTAAAGAAGGGCAAGTCGTACGTGTTCACCGTAGTCGTGGAC
AACATGGGCCTAGACGAAAATTGGATCATCGGCGAAGAGGAAATGAAGAACCCTCGCGGTATCCTGAACTACGAC
CTGTCCGGTCGCTCCGCTAGTGACATCAGCTGGAAGCTGACCGGAAACCTGGGTGGCGAGGACTACCTGGACAAA
GTACGCGGCCCACTCAACGAGGGAGGCCTATACGCCGAGCGCCAGGGATTCCACCAGACCCAGCCGCCGACCCAG
AGCTGGATATCCGACAGCCCCTTCGACGGCCTGTCTGCCCCTGGAATCAAGTTTTACAGTGCAAACTTCGATTTG
AACATCGAGAAGGGCTGGGATGTTCCTCTGTACTTTAACTTCGGGAACACCACCTCCTCGCCCGCGGCTTACCGT
GTCCAGCTCTATGTCAACGGGTACCAGTACGCCAAGTATGTGAACAATATCGGTCCTCAGACGAGCTTCCCTGTT
CCCGAGGGTATTCTCAACTACCAGGGTACCAACTATTTGGCTTTGAGTCTGTGGGTGCTTGAGTCGGATGGTGCT
AAGTTGGAGAGTCTGGACTTGATTCATACTACTCCTGTGCTGACGGCGCTGAAGGTTGAGTCGGTGGATCAGCCT
AAGTATAAGAAGCGTCAAGCGGCTTATTAG
Transcript >Pro_DTO070G2_2|g5746.t1
ATGAAGCTCTCGTCTTCTTGGGCCATTGCCTGTCTGGCAGCCCAGGCCGCTGGTGCTGCTATTACCCATTCGCTA
AATGGCTTTAGTATCACCGAGCACCCGGATCCCGTTAAGCGGGATTTGCTCCAGAAATACGTCACTTGGGATGAC
AAGTCTCTCTTTGTCAATGGCGAGAGAATCATGCTATTTAGTGGTGAAATCCACCCATATCGTCTGCCTGTTCCA
TCTTTGTGGATTGATGTGTTCCAAAAGGTTAAGGCTCTAGGATTTAACTGCGTTTCATTCTATATCGACTGGGCT
CTGCTGGAAGGTAAGCCGGGTCAGTATACTGCTGATGGAATATTTGCTCTGGAGCCATTCTTCGACGCCGCCAAA
GAGGCTGGCATCTATCTTCTGGCCCGTCCTGGTCCCTACATCAATGCTGAAGCATCGGGTGGTGGTTTCCCGGGA
TGGCTTCAGCGCGTGAATGGAACTCTACGAACTAGTGATGAGGCCTACCTGGAGGCAACGGACAACTACATTGCC
AATGTTGCCGCAACCATCGCGAAGGGTCAAATCACCAATGGAGGACCTGTCATTCTTTACCAACCCGAGAACGAG
TACAGTGGCGCTTGCTGTGGATACGACGGGTTTCCAGACGGTGCCTATATGCAATACGTGGAGGATCAGGCTCGG
AATGCTGGAATTGTCGTGCCTCTTATTAGCAACGATGCCTCAGCTGGTGGCCACAATGCCCCTGGAACTGGCGAA
GGGGCTGTGGATATCTATGGCCACGACAGCTACCCTCTCGGCTTTGACTGCGCAAACCCTTCTACTTGGCCAGCG
GGTAATCTGCCCACTTATTTCTATACCACACACATGGACCAGAGCCCTTCGACCCCATTCTCTCTAGTTGAGTTT
CAAGGTGGTGCCTTTGATCCCTGGGGAGGTGTTGGGTTCACGAAATGTGCTGCTCTCCTGAACCATGAGTTCGAG
AGAGTGTTTTATAAGAACAATCTCAGCTTCCGAGTTGCATTCCTCAACCTATACATGATCTTTGGTGGTACGAAT
TGGGGAAATCTGGGCCACCCCGGTGGATACACATCCTATGATTATGGTTCTCCGATTACTGAATCTCGAAACATC
ACCCGGGAGAAGTACAGCGAGCTGAAGCTGATTGGTAACTTTGTCAAAGTCTCACCGGCCTACCTTCTCTCAACA
CCAGGAGACTTGACCACTTCCAAGTACACAACCTCGTCTGATATAGCCGTGACTCCTCTGCTAGGAGACGACAAC
ACGGCTTCGTCCTTCTTCATCGTTCGACACTCCGACTACTCGAGCCAAGGGTCCGTCGACTATAAGCTCAAGGTT
CCTACTAGTGCCGGTGAAGTGACCATTCCCCAGCTTGGCGGGAGCCTCACTCTCAGCGGCCGTGATTCCAAGATT
CATGTCGTTAACTATGATGTGGCGGGCACCAACATCCTCTACTCCTCTGCTGAGGTGTTTACCTGGACGGGGTCT
GGTAAGTCCAAGATTCTTGTCTTGTACAGCGGCCCCGGCGAGCATCACGAGCTGGCTGTCTCTTCCCAGTCGAAG
GCTTCGGTTATTGAAGGCTCGTCGTCGAACATCACCATTAAGCAGGTGGGTAAGGCGGTTGTTATCGGTTGGGAC
GTCTCAGTCACTCGCCGTATTGTGCAAGTGGGTGATCTGAAGATAATTCTTCTGGATCGGAACTCTGCCTACAAC
TACTGGGTCCCTCAGCTCCCAACCAAGGGAACACGCCCTGGTTATAGTTCCCAAGAGGCAGCCGCCTCGTCTCTC
ATCGTCAAGGCTGGTTACCTCGTGCGGACTGCTTATCTGCAGGGCAATGACCTTCATCTCACTGCTGATTTCAAC
GCCACGACCCCGATTGAGGTAATTGGCGCTCCGACCAATGCCAAGAACCTGATTATCAACGGGAAGAAAGCGCAG
GTCAAGATCGACAAGAACGGAATCTGGTCCAGCAGCGTCGTCTATACCGCACCGAAGATCGAGCTTCCTATTCTG
AAGAGGCTAAAGTGGAAGTCTATTGATACTCTACCCGAGATTCAAGACTCTTACGATGATTCCACATGGGTTCCA
GCAAACAAACCCACCAAAAATAGCGTCCATGAACTCAAGACTCCTATCTCGCTACTCTCCTCTGACTACGGATTC
CACACCGGAACCCTCCTCTTCCGGGGCCACTTCGTCGCAACCGGTAACGAGAAAACTTTCTTCGTGCAGACTCAA
GGGGGTAGCGCATTCGGCAGCTCAGTATGGTTGAACGAGAACCACCTAGGATCATGGGGTGGAATATCCATTGAC
AGCGACCACAACAGAACCTACACACTACCAACTCTAAAGAAGGGCAAGTCGTACGTGTTCACCGTAGTCGTGGAC
AACATGGGCCTAGACGAAAATTGGATCATCGGCGAAGAGGAAATGAAGAACCCTCGCGGTATCCTGAACTACGAC
CTGTCCGGTCGCTCCGCTAGTGACATCAGCTGGAAGCTGACCGGAAACCTGGGTGGCGAGGACTACCTGGACAAA
GTACGCGGCCCACTCAACGAGGGAGGCCTATACGCCGAGCGCCAGGGATTCCACCAGACCCAGCCGCCGACCCAG
AGCTGGATATCCGACAGCCCCTTCGACGGCCTGTCTGCCCCTGGAATCAAGTTTTACAGTGCAAACTTCGATTTG
AACATCGAGAAGGGCTGGGATGTTCCTCTGTACTTTAACTTCGGGAACACCACCTCCTCGCCCGCGGCTTACCGT
GTCCAGCTCTATGTCAACGGGTACCAGTACGCCAAGTATGTGAACAATATCGGTCCTCAGACGAGCTTCCCTGTT
CCCGAGGGTATTCTCAACTACCAGGGTACCAACTATTTGGCTTTGAGTCTGTGGGTGCTTGAGTCGGATGGTGCT
AAGTTGGAGAGTCTGGACTTGATTCATACTACTCCTGTGCTGACGGCGCTGAAGGTTGAGTCGGTGGATCAGCCT
AAGTATAAGAAGCGTCAAGCGGCTTATTAG
Gene >Pro_DTO070G2_2|g5746.t1
ATGAAGCTCTCGTCTTCTTGGGCCATTGCCTGTCTGGCAGCCCAGGCCGCTGGTGCTGCTATTACCCATTCGCTA
AATGGCTTTAGTATCACCGAGCACCCGGATCCCGTTAAGCGGGATTTGCTCCAGAAATACGTATGTTGGGTTGGT
CCTTGGATTAGGATGATTGTGTTGACAAGCAAATTGTATAGGTCACTTGGGATGACAAGTCTCTCTTTGTCAATG
GCGAGAGAATCATGCTATTTAGTGGTGAAATCCACCCATATCGGTAAGCTGGAAGGCATCAATGAGCCCTTTCAA
GAAAGAATCATGCTAACCAAGATTCCTGCAGTCTGCCTGTTCCATCTTTGTGGATTGATGTGTTCCAAAAGGTTA
AGGCTCTAGGATTTAACTGCGTTTCATTCTATATCGACTGGGCTCTGCTGGAAGGTAAGCCGGGTCAGTATACTG
CTGATGGAATATTTGCTCTGGAGCCATTCTTCGACGCCGCCAAAGAGGCTGGCATCTATCTTCTGGCCCGTCCTG
GTCCCTACATCAATGCTGAAGCATCGGGTGGTGGTTTCCCGGGATGGCTTCAGCGCGTGAATGGAACTCTACGAA
CTAGTGATGAGGCCTACCTGGAGGCAACGGACAAGTATGTGATCCTTTCGAAACGTAAGACTTAAAGCACGGTGA
ATACTGACATAGATAATTAGCTACATTGCCAATGTTGCCGCAACCATCGCGAAGGGTCAAATCACCAATGGAGGA
CCTGTCATTCTTTACCAACCCGAGAACGAGTACAGTGGCGCTTGCTGTGGATACGACGGGTTTCCAGACGGTGCC
TATATGCAATACGTGGAGGATCAGGCTCGGAATGCTGGAATTGTCGTGCCTCTTATTAGCAACGATGCCTCAGCT
GGTGGCCACAATGCCCCTGGAACTGGCGAAGGGGCTGTGGATATCTATGGCCACGACAGCTACCCTCTCGGCTTT
GACTGCGCAAACCCTTCTACTTGGCCAGCGGGTAATCTGCCCACTTATTTCTATACCACACACATGGACCAGAGC
CCTTCGACCCCATTCTCTCTAGTTGAGGTAAGATATATGGATATCTCCTGTGTGGACTATCAATCTAACTGGAGT
TTAGTTTCAAGGTGGTGCCTTTGATCCCTGGGGAGGTGTTGGGTTCACGAAATGTGCTGCTCTCCTGAACCATGA
GTTCGAGAGAGTGTTTTATAAGAACAATCTCAGCTTCCGAGTTGCATTCCTCAACCTATACATGGTATGTTCCGG
CTCTCATATCATAATCACCATTCTAATCTCTCACCGGTAGATCTTTGGTGGTACGAATTGGGGAAATCTGGGCCA
CCCCGGTGGATACACATCCTATGATTATGGTTCTCCGATTACTGAATCTCGAAACATCACCCGGGAGAAGTACAG
CGAGCTGAAGCTGATTGGTAACTTTGTCAAAGTCTCACCGGCCTACCTTCTCTCAACACCAGGAGACTTGACCAC
TTCCAAGTACACAACCTCGTCTGATATAGCCGTGACTCCTCTGCTAGGAGACGACAACACGGCTTCGTCCTTCTT
CATCGTTCGACACTCCGACTACTCGAGCCAAGGGTCCGTCGACTATAAGCTCAAGGTTCCTACTAGTGCCGGTGA
AGTGACCATTCCCCAGCTTGGCGGGAGCCTCACTCTCAGCGGCCGTGATTCCAAGATTCATGTCGTTAACTATGA
TGTGGCGGGCACCAACATCCTCTACTCCTCTGCTGAGGTGTTTACCTGGACGGGGTCTGGTAAGTCCAAGATTCT
TGTCTTGTACAGCGGCCCCGGCGAGCATCACGAGCTGGCTGTCTCTTCCCAGTCGAAGGCTTCGGTTATTGAAGG
CTCGTCGTCGAACATCACCATTAAGCAGGTGGGTAAGGCGGTTGTTATCGGTTGGGACGTCTCAGTCACTCGCCG
TATTGTGCAAGTGGGTGATCTGAAGATAATTCTTCTGGGTAAGTGCTTTCTCCGATACCGCTCTGCTTCATCGCA
ACTGACTAAACTACTAGATCGGAACTCTGCCTACAACTACTGGGTCCCTCAGCTCCCAACCAAGGGAACACGCCC
TGGTTATAGTTCCCAAGAGGCAGCCGCCTCGTCTCTCATCGTCAAGGCTGGTTACCTCGTGCGGACTGCTTATCT
GCAGGGCAATGACCTTCATCTCACTGCTGATTTCAACGCCACGACCCCGATTGAGGTAATTGGCGCTCCGACCAA
TGCCAAGAACCTGATTATCAACGGGAAGAAAGCGCAGGTCAAGATCGACAAGAACGGAATCTGGTCCAGCAGCGT
CGTCTATACCGCACCGAAGATCGAGCTTCCTATTCTGAAGAGGCTAAAGTGGAAGTCTATTGATACTCTACCCGA
GATTCAAGACTCTTACGATGATTCCACATGGGTTCCAGCAAACAAACCCACCAAAAATAGCGTCCATGAACTCAA
GACTCCTATCTCGCTACTCTCCTCTGACTACGGATTCCACACCGGAACCCTCCTCTTCCGGGGCCACTTCGTCGC
AACCGGTAACGAGAAAACTTTCTTCGTGCAGACTCAAGGGGGTAGCGCATTCGGCAGCTCAGTATGGTTGAACGA
GAACCACCTAGGATCATGGGGTGGAATATCCATTGACAGCGACCACAACAGAACCTACACACTACCAACTCTAAA
GAAGGGCAAGTCGTACGTGTTCACCGTAGTCGTGGACAACATGGGCCTAGACGAAAATTGGATCATCGGCGAAGA
GGAAATGAAGAACCCTCGCGGTATCCTGAACTACGACCTGTCCGGTCGCTCCGCTAGTGACATCAGCTGGAAGCT
GACCGGAAACCTGGGTGGCGAGGACTACCTGGACAAAGTACGCGGCCCACTCAACGAGGGAGGCCTATACGCCGA
GCGCCAGGGATTCCACCAGACCCAGCCGCCGACCCAGAGCTGGATATCCGACAGCCCCTTCGACGGCCTGTCTGC
CCCTGGAATCAAGTTTTACAGTGCAAACTTCGATTTGAACATCGAGAAGGGCTGGGATGTTCCTCTGTACTTTAA
CTTCGGGAACACCACCTCCTCGCCCGCGGCTTACCGTGTCCAGCTCTATGTCAACGGGTACCAGTACGCCAAGTA
TGTGAACAATATCGGTCCTCAGACGAGCTTCCCTGTTCCCGAGGGTATTCTCAACTACCAGGGTACCAACTATTT
GGCTTTGAGTCTGTGGGTGCTTGAGTCGGATGGTGCTAAGTTGGAGAGTCTGGACTTGATTCATACTACTCCTGT
GCTGACGGCGCTGAAGGTTGAGTCGGTGGATCAGCCTAAGTATAAGAAGCGTCAAGCGGCTTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail