Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g5667.t1
Gene name
Locationscaffold_07:655709..659068
Strand-
Gene length (bp)3359
Transcript length (bp)3213
Coding sequence length (bp)3213
Protein length (aa) 1071

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03636 Glyco_hydro_65N Glycosyl hydrolase family 65, N-terminal domain 4.7E-32 68 329
PF03632 Glyco_hydro_65m Glycosyl hydrolase family 65 central catalytic domain 7.7E-18 423 609

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g5667.t1
MRFKSFTCAALPLFLNLVSGSPDSRIKRCFREHTSSSSANFSNNVYQTGFDGVIWDEDNWLLSSTNLEQGRFQSR
GSVANGYLGINVASAGPFFEIDSPDDTNGWPLFSRRQTFATVSGFFDSQPTTNGSNFPWLSQYGDDSVISGVPHW
AGIILDLGNDTYLDAKVDNKSISNFRTTYDFKAGILVWSYKWTPRGNRGSYQITYRLLAHKLYVNQAVVEMEIIP
TKELNATIVNVIDGASAVRSDFVETGEDNGAIFSAVRPNGIANVTAYIYANLTGSPHVDLSSRKIVPSKPYVHSN
KSSIAQSVDVKFKPGQLVRVIKYVGGASTDAFVDPKQTAKKAASAAMSNGYAQSLRTHLMEWENVMPQDSVDHYA
FPNGTLPADSHIIDLAVISVANTYYLLQNTAGKNAVKEAAGAPINVDSISVGGLTSDSYGGQVFWDADVWMQPGL
VVSHPEASERFTNFRVAKYAQARENIQTSFSGSQNQTNFSPSAAIFPWTSGRFGNCTATGACWDYEYHLNGDIGI
SLINQWVASGNTKLFKEEHFPIYDSAATLYADLLVRNGSYWTLTNMTDPDEYANHVDAGGFTMPLIAETLRHANA
FRQQFGLEENATWDQMADNVLVLRENEVTLEFTTMNGSAVVKQADVVMVTYPLGYTANYTSQNSLNDLDYYAAKQ
SADGPAMTWAIFSVVANGMSLSGCSSYAYAQYSYKPYTRAPFFQMSEQMVDNATINGGTHPAYPFLTGHGGSNQV
AIFGYLGLRLVPDDILHVDPNLPPQIPYLKYRTFYWRGWPFSAWSNYTHTTISHSTEAAPLETADQRFANKTITI
HSGQEVDTTIYHLPLKGSVVIPNRQTGSENTVKGNLVQCQAVSSSDAFEPGQFPISAVDGAASTKWQPSLAAELS
SVTVSFEDEAGAMVFGFYFDWAQTPPVNATVIFHNKTLEDPATALSTQSSDYTIVHRLINIVQSNPYDPDTTNLD
RVAIPTGNTTNVTLSSPIPAARYASLLIVGNQALDSVDVEAKNGTGATVAEWAILGQANASTASASKSANKKMKV
RVAGTLANTDAFMRRRQFLF*
Coding >Pro_DTO070G2_2|g5667.t1
ATGCGGTTTAAATCCTTCACATGCGCGGCATTGCCCCTATTTCTGAATCTTGTTAGCGGCTCTCCCGACAGTCGT
ATCAAAAGGTGCTTTAGGGAACACACAAGCTCTAGCTCGGCCAACTTCAGCAACAATGTTTACCAGACCGGCTTC
GATGGTGTGATCTGGGACGAAGACAACTGGCTTCTGAGCTCAACCAACTTGGAACAGGGTCGTTTTCAATCTCGA
GGATCCGTGGCGAACGGATATCTGGGTATTAATGTTGCCAGTGCTGGTCCTTTCTTTGAGATTGATAGTCCCGAT
GACACCAACGGCTGGCCACTTTTCTCTAGACGCCAGACCTTCGCAACGGTCAGTGGGTTCTTTGACTCACAGCCT
ACCACCAACGGCAGCAACTTCCCCTGGTTGTCCCAGTATGGAGACGATAGTGTGATCAGTGGTGTTCCCCACTGG
GCCGGAATCATCTTGGATCTCGGCAATGATACATATTTGGATGCAAAAGTCGACAATAAGAGCATTTCCAATTTC
CGAACCACATACGACTTCAAAGCAGGCATCTTGGTCTGGTCCTACAAATGGACGCCTCGGGGCAACAGGGGATCG
TACCAGATTACCTATCGTCTTCTCGCCCACAAGCTGTATGTCAATCAGGCTGTGGTCGAAATGGAGATTATCCCG
ACCAAGGAATTGAATGCGACCATCGTCAATGTCATTGATGGAGCTTCTGCAGTGCGCAGCGACTTCGTAGAGACC
GGGGAAGACAATGGTGCAATCTTCTCAGCAGTACGGCCGAATGGGATTGCTAATGTCACAGCTTATATCTACGCG
AACCTCACTGGGTCGCCCCATGTGGATCTCTCTTCGCGCAAGATTGTGCCCAGCAAGCCATATGTCCATTCCAAC
AAATCGTCTATTGCGCAATCCGTAGATGTGAAGTTCAAGCCTGGGCAATTAGTTCGTGTCATCAAGTATGTCGGA
GGTGCTTCTACGGATGCCTTTGTTGATCCGAAACAAACAGCCAAGAAGGCTGCCTCCGCTGCTATGAGCAATGGC
TACGCCCAGTCTCTTCGAACTCATCTCATGGAATGGGAAAACGTTATGCCCCAAGATTCGGTTGACCACTACGCA
TTTCCCAATGGCACATTGCCTGCAGATAGCCACATCATTGATTTGGCAGTAATCTCCGTGGCTAACACTTACTAC
TTGCTGCAGAATACTGCTGGCAAGAATGCAGTCAAGGAAGCTGCGGGAGCACCGATAAATGTGGACAGTATCTCA
GTTGGTGGCTTGACCTCTGACTCCTATGGAGGCCAAGTCTTCTGGGATGCGGATGTATGGATGCAGCCTGGTCTT
GTTGTTTCTCACCCAGAAGCGTCCGAGCGGTTCACCAATTTCCGTGTGGCAAAGTATGCCCAAGCACGGGAGAAT
ATCCAGACTAGCTTTTCTGGCTCCCAGAACCAGACAAATTTCAGTCCGTCAGCTGCAATCTTCCCTTGGACTAGT
GGCCGGTTTGGCAACTGCACGGCTACTGGCGCCTGCTGGGACTACGAATATCATCTGAACGGAGACATCGGAATC
TCCTTGATTAACCAATGGGTTGCAAGTGGTAATACAAAGTTATTCAAAGAGGAACATTTCCCAATCTACGATTCG
GCGGCTACGCTCTATGCGGACTTGCTGGTTCGAAACGGGTCTTATTGGACATTGACCAACATGACTGACCCTGAT
GAGTATGCCAACCACGTTGATGCGGGTGGTTTCACAATGCCACTCATTGCCGAGACCCTCCGACATGCCAACGCC
TTCCGTCAGCAATTCGGACTTGAAGAAAATGCTACCTGGGATCAAATGGCTGACAATGTCTTGGTGCTTCGTGAA
AACGAGGTGACTCTCGAATTCACTACCATGAATGGAAGCGCTGTGGTTAAACAAGCTGACGTGGTTATGGTCACC
TATCCCCTGGGCTATACTGCCAATTACACCAGCCAAAATTCGCTGAATGATCTGGACTATTACGCAGCGAAACAA
TCTGCTGATGGTCCTGCCATGACCTGGGCTATCTTTTCTGTCGTCGCAAACGGAATGTCGCTATCTGGCTGCTCA
TCATACGCATATGCGCAGTACTCATACAAGCCTTATACCCGTGCGCCATTCTTCCAAATGTCGGAACAGATGGTG
GATAACGCTACCATTAATGGAGGCACGCACCCGGCGTATCCATTCCTGACTGGCCACGGTGGTTCCAATCAGGTC
GCTATCTTTGGTTATCTTGGATTGCGGCTGGTACCAGATGACATTCTTCACGTGGATCCAAATTTGCCCCCCCAG
ATTCCATACCTGAAGTATCGTACCTTCTACTGGCGCGGCTGGCCCTTCTCGGCGTGGTCAAATTACACACACACG
ACCATCAGCCATTCCACAGAGGCTGCACCACTGGAGACTGCCGATCAACGATTCGCCAACAAAACAATCACGATT
CACTCTGGCCAAGAAGTCGATACCACCATTTACCATCTTCCTCTCAAGGGCTCTGTTGTCATTCCTAACCGACAG
ACTGGATCGGAGAACACCGTAAAAGGTAATCTCGTGCAGTGCCAGGCTGTTTCCTCTTCGGATGCATTCGAACCT
GGCCAATTCCCTATTTCCGCGGTAGACGGTGCAGCCTCGACAAAATGGCAGCCCTCACTGGCAGCTGAGCTAAGC
TCCGTGACAGTCTCCTTCGAAGATGAGGCTGGCGCTATGGTATTCGGTTTCTACTTCGATTGGGCGCAGACACCC
CCGGTTAATGCCACTGTTATCTTCCACAATAAGACCCTGGAAGATCCTGCGACGGCGCTTTCCACTCAAAGCTCG
GACTACACAATTGTGCACCGCCTGATAAACATCGTTCAATCGAACCCATACGATCCTGATACCACAAACCTCGAT
AGGGTTGCCATCCCTACCGGAAACACAACCAATGTGACTTTATCATCTCCCATACCAGCAGCACGCTATGCGTCT
CTTCTTATTGTGGGAAACCAAGCCCTTGACTCTGTTGATGTGGAGGCTAAGAATGGGACTGGTGCGACTGTTGCC
GAGTGGGCTATTCTCGGGCAAGCAAACGCAAGCACTGCCTCAGCCTCCAAATCTGCAAATAAGAAGATGAAAGTG
CGTGTAGCAGGAACCTTGGCAAATACGGATGCCTTTATGCGTCGGCGTCAGTTTCTATTCTAA
Transcript >Pro_DTO070G2_2|g5667.t1
ATGCGGTTTAAATCCTTCACATGCGCGGCATTGCCCCTATTTCTGAATCTTGTTAGCGGCTCTCCCGACAGTCGT
ATCAAAAGGTGCTTTAGGGAACACACAAGCTCTAGCTCGGCCAACTTCAGCAACAATGTTTACCAGACCGGCTTC
GATGGTGTGATCTGGGACGAAGACAACTGGCTTCTGAGCTCAACCAACTTGGAACAGGGTCGTTTTCAATCTCGA
GGATCCGTGGCGAACGGATATCTGGGTATTAATGTTGCCAGTGCTGGTCCTTTCTTTGAGATTGATAGTCCCGAT
GACACCAACGGCTGGCCACTTTTCTCTAGACGCCAGACCTTCGCAACGGTCAGTGGGTTCTTTGACTCACAGCCT
ACCACCAACGGCAGCAACTTCCCCTGGTTGTCCCAGTATGGAGACGATAGTGTGATCAGTGGTGTTCCCCACTGG
GCCGGAATCATCTTGGATCTCGGCAATGATACATATTTGGATGCAAAAGTCGACAATAAGAGCATTTCCAATTTC
CGAACCACATACGACTTCAAAGCAGGCATCTTGGTCTGGTCCTACAAATGGACGCCTCGGGGCAACAGGGGATCG
TACCAGATTACCTATCGTCTTCTCGCCCACAAGCTGTATGTCAATCAGGCTGTGGTCGAAATGGAGATTATCCCG
ACCAAGGAATTGAATGCGACCATCGTCAATGTCATTGATGGAGCTTCTGCAGTGCGCAGCGACTTCGTAGAGACC
GGGGAAGACAATGGTGCAATCTTCTCAGCAGTACGGCCGAATGGGATTGCTAATGTCACAGCTTATATCTACGCG
AACCTCACTGGGTCGCCCCATGTGGATCTCTCTTCGCGCAAGATTGTGCCCAGCAAGCCATATGTCCATTCCAAC
AAATCGTCTATTGCGCAATCCGTAGATGTGAAGTTCAAGCCTGGGCAATTAGTTCGTGTCATCAAGTATGTCGGA
GGTGCTTCTACGGATGCCTTTGTTGATCCGAAACAAACAGCCAAGAAGGCTGCCTCCGCTGCTATGAGCAATGGC
TACGCCCAGTCTCTTCGAACTCATCTCATGGAATGGGAAAACGTTATGCCCCAAGATTCGGTTGACCACTACGCA
TTTCCCAATGGCACATTGCCTGCAGATAGCCACATCATTGATTTGGCAGTAATCTCCGTGGCTAACACTTACTAC
TTGCTGCAGAATACTGCTGGCAAGAATGCAGTCAAGGAAGCTGCGGGAGCACCGATAAATGTGGACAGTATCTCA
GTTGGTGGCTTGACCTCTGACTCCTATGGAGGCCAAGTCTTCTGGGATGCGGATGTATGGATGCAGCCTGGTCTT
GTTGTTTCTCACCCAGAAGCGTCCGAGCGGTTCACCAATTTCCGTGTGGCAAAGTATGCCCAAGCACGGGAGAAT
ATCCAGACTAGCTTTTCTGGCTCCCAGAACCAGACAAATTTCAGTCCGTCAGCTGCAATCTTCCCTTGGACTAGT
GGCCGGTTTGGCAACTGCACGGCTACTGGCGCCTGCTGGGACTACGAATATCATCTGAACGGAGACATCGGAATC
TCCTTGATTAACCAATGGGTTGCAAGTGGTAATACAAAGTTATTCAAAGAGGAACATTTCCCAATCTACGATTCG
GCGGCTACGCTCTATGCGGACTTGCTGGTTCGAAACGGGTCTTATTGGACATTGACCAACATGACTGACCCTGAT
GAGTATGCCAACCACGTTGATGCGGGTGGTTTCACAATGCCACTCATTGCCGAGACCCTCCGACATGCCAACGCC
TTCCGTCAGCAATTCGGACTTGAAGAAAATGCTACCTGGGATCAAATGGCTGACAATGTCTTGGTGCTTCGTGAA
AACGAGGTGACTCTCGAATTCACTACCATGAATGGAAGCGCTGTGGTTAAACAAGCTGACGTGGTTATGGTCACC
TATCCCCTGGGCTATACTGCCAATTACACCAGCCAAAATTCGCTGAATGATCTGGACTATTACGCAGCGAAACAA
TCTGCTGATGGTCCTGCCATGACCTGGGCTATCTTTTCTGTCGTCGCAAACGGAATGTCGCTATCTGGCTGCTCA
TCATACGCATATGCGCAGTACTCATACAAGCCTTATACCCGTGCGCCATTCTTCCAAATGTCGGAACAGATGGTG
GATAACGCTACCATTAATGGAGGCACGCACCCGGCGTATCCATTCCTGACTGGCCACGGTGGTTCCAATCAGGTC
GCTATCTTTGGTTATCTTGGATTGCGGCTGGTACCAGATGACATTCTTCACGTGGATCCAAATTTGCCCCCCCAG
ATTCCATACCTGAAGTATCGTACCTTCTACTGGCGCGGCTGGCCCTTCTCGGCGTGGTCAAATTACACACACACG
ACCATCAGCCATTCCACAGAGGCTGCACCACTGGAGACTGCCGATCAACGATTCGCCAACAAAACAATCACGATT
CACTCTGGCCAAGAAGTCGATACCACCATTTACCATCTTCCTCTCAAGGGCTCTGTTGTCATTCCTAACCGACAG
ACTGGATCGGAGAACACCGTAAAAGGTAATCTCGTGCAGTGCCAGGCTGTTTCCTCTTCGGATGCATTCGAACCT
GGCCAATTCCCTATTTCCGCGGTAGACGGTGCAGCCTCGACAAAATGGCAGCCCTCACTGGCAGCTGAGCTAAGC
TCCGTGACAGTCTCCTTCGAAGATGAGGCTGGCGCTATGGTATTCGGTTTCTACTTCGATTGGGCGCAGACACCC
CCGGTTAATGCCACTGTTATCTTCCACAATAAGACCCTGGAAGATCCTGCGACGGCGCTTTCCACTCAAAGCTCG
GACTACACAATTGTGCACCGCCTGATAAACATCGTTCAATCGAACCCATACGATCCTGATACCACAAACCTCGAT
AGGGTTGCCATCCCTACCGGAAACACAACCAATGTGACTTTATCATCTCCCATACCAGCAGCACGCTATGCGTCT
CTTCTTATTGTGGGAAACCAAGCCCTTGACTCTGTTGATGTGGAGGCTAAGAATGGGACTGGTGCGACTGTTGCC
GAGTGGGCTATTCTCGGGCAAGCAAACGCAAGCACTGCCTCAGCCTCCAAATCTGCAAATAAGAAGATGAAAGTG
CGTGTAGCAGGAACCTTGGCAAATACGGATGCCTTTATGCGTCGGCGTCAGTTTCTATTCTAA
Gene >Pro_DTO070G2_2|g5667.t1
ATGCGGTTTAAAGTGAGTTTGTACTCCTATGTCCTTGCTGATCATCTAACACTCTGCTTAGTCCTTCACATGCGC
GGCATTGCCCCTATTTCTGAATCTTGTTAGCGGCTCTCCCGACAGTCGTATCAAAAGGTGCTTTAGGGAACACAC
AAGCTCTAGCTCGGCCAACTTCAGCAACAATGTTTACCAGACCGGCTTCGATGGTGTGATCTGGGACGAAGACAA
CTGGCTTCTGAGCTCAACCAACTTGGAACAGGGTCGTTTTCAATCTCGAGGATCCGTGGCGAACGGATATCTGGG
TATTAATGTTGCCAGTGCTGGTCCTTTCTTTGAGATTGATAGTCCCGATGACACCAACGGCTGGCCACTTTTCTC
TAGACGCCAGACCTTCGCAACGGTCAGTGGGTTCTTTGACTCACAGCCTACCACCAACGGCAGCAACTTCCCCTG
GTTGTCCCAGTATGGAGACGATAGTGTGATCAGTGGTGTTCCCCACTGGGCCGGAATCATCTTGGATCTCGGCAA
TGATACATATTTGGATGCAAAAGTCGACAATAAGAGCATTTCCAATTTCCGAACCACATACGACTTCAAAGCAGG
CATCTTGGTCTGGTCCTACAAATGGACGCCTCGGGGCAACAGGGGATCGTACCAGATTACCTATCGTCTTCTCGC
CCACAAGCTGTATGTCAATCAGGCTGTGGTCGAAATGGAGATTATCCCGACCAAGGAATTGAATGCGACCATCGT
CAATGTCATTGATGGAGCTTCTGCAGTGCGCAGCGACTTCGTAGAGACCGGGGAAGACAATGGTGCAATCTTCTC
AGCAGTACGGCCGAATGGGATTGCTAATGTCACAGCTTATATCTACGCGAACCTCACTGGGTCGCCCCATGTGGA
TCTCTCTTCGCGCAAGATTGTGCCCAGCAAGCCATATGTCCATTCCAACAAATCGTCTATTGCGCAATCCGTAGA
TGTGAAGTTCAAGCCTGGGCAATTAGTTCGTGTCATCAAGTATGTCGGAGGTGCTTCTACGGATGCCTTTGTTGA
TCCGAAACAAACAGCCAAGAAGGCTGCCTCCGCTGCTATGAGCAATGGCTACGCCCAGTCTCTTCGAACTCATCT
CATGGAATGGGAAAACGTTATGCCCCAAGATTCGGTTGACCACTACGCATTTCCCAATGGCACATTGCCTGCAGA
TAGCCACATCATTGATTTGGCAGTAATCTCCGTGGCTAACACTTACTACTTGCTGCAGAATACTGCTGGCAAGAA
TGCAGTCAAGGAAGCTGCGGGAGCACCGATAAATGTGGACAGTATCTCAGTTGGTGGCTTGACCTCTGACTCCTA
TGGAGGCCAAGTCTTCTGGGATGCGGATGTATGGATGCAGCCTGGTCTTGTTGTTTCTCACCCAGAAGCGTCCGA
GCGGTTCACCAATTTCCGTGTGGCAAAGTATGCCCAAGCACGGGAGAATATCCAGACTAGCTTTTCTGGCTCCCA
GAACCAGACAAATTTCAGTCCGTCAGCTGCAATCTTCCCTTGGACTAGTGGCCGGTTTGGCAACTGCACGGCTAC
TGGCGCCTGCTGGGACTACGAATATCATCTGAACGGAGACATCGGAATCTCCTTGATTAACCAATGGGTTGCAAG
TGGTAATACAAAGTTATTCAAAGAGGAACATTTCCCAATCTACGATTCGGCGGCTACGCTCTATGCGGACTTGCT
GGTTCGAAACGGGTCTTATTGGACATTGACCAACATGACTGACCCTGTAAGTCTGGCGCCCATCTCTTTACAGCA
CCCAAAACTAATATAAAGTAGGATGAGTATGCCAACCACGTTGATGCGGGTGGTTTCACAATGCCACTCATTGCC
GAGACCCTCCGACATGCCAACGCCTTCCGTCAGCAATTCGGACTTGAAGAAAATGCTACCTGGGATCAAATGGCT
GACAATGTCTTGGTGCTTCGTGAAAACGAGGTGACTCTCGAATTCACTACCATGAATGGAAGCGCTGTGGTTAAA
CAAGCTGACGTGGTTATGGTCACCTATCCCCTGGGCTATACTGCCAATTACACCAGCCAAAATTCGCTGAATGAT
CTGGACTATGTAAGTATTTTGATTCCCGGAAAGAGAGCCAAACTAACAAGATCTAGTACGCAGCGAAACAATCTG
CTGATGGTCCTGCCATGACCTGGGCTATCTTTTCTGTCGTCGCAAACGGAATGTCGCTATCTGGCTGCTCATCAT
ACGCATATGCGCAGTACTCATACAAGCCTTATACCCGTGCGCCATTCTTCCAAATGTCGGAACAGATGGTGGATA
ACGCTACCATTAATGGAGGCACGCACCCGGCGTATCCATTCCTGACTGGCCACGGTGGTTCCAATCAGGTCGCTA
TCTTTGGTTATCTTGGATTGCGGCTGGTACCAGATGACATTCTTCACGTGGATCCAAATTTGCCCCCCCAGATTC
CATACCTGAAGTATCGTACCTTCTACTGGCGCGGCTGGCCCTTCTCGGCGTGGTCAAATTACACACACACGACCA
TCAGCCATTCCACAGAGGCTGCACCACTGGAGACTGCCGATCAACGATTCGCCAACAAAACAATCACGATTCACT
CTGGCCAAGAAGTCGATACCACCATTTACCATCTTCCTCTCAAGGGCTCTGTTGTCATTCCTAACCGACAGACTG
GATCGGAGAACACCGTAAAAGGTAATCTCGTGCAGTGCCAGGCTGTTTCCTCTTCGGATGCATTCGAACCTGGCC
AATTCCCTATTTCCGCGGTAGACGGTGCAGCCTCGACAAAATGGCAGCCCTCACTGGCAGCTGAGCTAAGCTCCG
TGACAGTCTCCTTCGAAGATGAGGCTGGCGCTATGGTATTCGGTTTCTACTTCGATTGGGCGCAGACACCCCCGG
TTAATGCCACTGTTATCTTCCACAATAAGACCCTGGAAGATCCTGCGACGGCGCTTTCCACTCAAAGCTCGGACT
ACACAATTGTGCACCGCCTGATAAACATCGTTCAATCGAACCCATACGATCCTGATACCACAAACCTCGATAGGG
TTGCCATCCCTACCGGAAACACAACCAATGTGACTTTATCATCTCCCATACCAGCAGCACGCTATGCGTCTCTTC
TTATTGTGGGAAACCAAGCCCTTGACTCTGTTGATGTGGAGGCTAAGAATGGGACTGGTGCGACTGTTGCCGAGT
GGGCTATTCTCGGGCAAGCAAACGCAAGCACTGCCTCAGCCTCCAAATCTGCAAATAAGAAGATGAAAGTGCGTG
TAGCAGGAACCTTGGCAAATACGGATGCCTTTATGCGTCGGCGTCAGTTTCTATTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail