Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g5666.t1
Gene name
Locationscaffold_07:653058..655496
Strand+
Gene length (bp)2438
Transcript length (bp)2184
Coding sequence length (bp)2184
Protein length (aa) 728

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00199 Catalase Catalase 2.2E-162 57 439
PF18011 Catalase_C C-terminal domain found in long catalases 1.3E-52 567 724
PF06628 Catalase-rel Catalase-related immune-responsive 4.0E-17 473 536

GO

GO Term Description Terminal node
GO:0004096 catalase activity Yes
GO:0020037 heme binding Yes
GO:0016491 oxidoreductase activity No
GO:0016209 antioxidant activity No
GO:0005488 binding No
GO:0004601 peroxidase activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0097159 organic cyclic compound binding No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0046906 tetrapyrrole binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g5666.t1
MRVLALVTGLVGIANAACPYMTGEAGPLERRGDGDASSTEEFLSQFYLKDQDVFLTSDVGGPIEDQNSLSAGERG
ATLLEDFIFRQKIQRFDHERVPERAVHARGAGAHGTFTSYGDWSNLTAASFLSAKGKQTPMFTRFSTVAGSRGSA
DTARDVHGFATRFYTDEGNFDIVGNNIPVFFIQDAILFPDLIHAVKPRGDSEIPQAATAHDSAWDFFSQQPSALH
TLLWAMAGHGIPRSFRHVDGFGVHTFRLVTDDGKTKLVKFHWKGLQGKASFVWEEAQQTAGKNADFMRQDLFEAI
EAGRFPEWELGVQIMEEDDQLRFGFDLLDPTKIVPEELVPVTKLGKMQLNRNPLNYFAETEQVMFQPGHIVRGVD
FTEDPLLQGRIFSYLDTQLNRHGGPNFEQLPINRPRVPIHNNNRDGAGQMFIPLNPNAYSPNTENNGSPKQANQT
VGNGFFTAPDRTSSGKLQRTVSSTFEDVWSQPRLFWNSLVPAEKQFIVDAIRFETSNVKSSVVRNNVIIQLNRIS
NDLATRVAKAIGIDAPKPDPTFYHDNTTAHIGAFGQKLAKLDGLKVGLLASVDKPASIAQGAKLQSALSAVGVDV
VVVAERFADGVNQTYSASDAVQFDAVVVADGAEGLFASKSITSVPNKASGASSLYPAGRPLDILLDAFRFGKTVG
ALGKGSAALRSALISTDRDGVYTASNAGSAFVKDIKEGLRTFKFLDRFALDE*
Coding >Pro_DTO070G2_2|g5666.t1
ATGCGTGTGCTTGCCCTCGTTACGGGTCTTGTTGGCATTGCCAATGCTGCCTGTCCTTATATGACTGGCGAAGCT
GGCCCCCTCGAGAGACGAGGTGATGGAGATGCTTCTTCCACCGAGGAATTTCTCTCCCAATTCTACCTCAAGGAC
CAAGATGTCTTTCTGACCTCCGATGTTGGCGGCCCGATCGAGGACCAAAACAGTCTCAGCGCAGGAGAGCGTGGA
GCCACCCTGCTTGAGGATTTCATTTTCCGCCAGAAGATCCAACGCTTCGACCATGAACGGGTACCGGAACGCGCC
GTTCATGCTCGAGGCGCCGGCGCCCACGGAACATTCACCTCGTACGGCGACTGGTCCAACCTGACTGCCGCGTCT
TTCCTTTCTGCCAAAGGCAAACAAACCCCGATGTTCACGCGCTTCTCTACTGTTGCTGGCAGTCGCGGAAGCGCC
GATACTGCGCGAGATGTCCACGGCTTTGCGACTCGCTTCTATACTGATGAAGGGAACTTCGATATTGTTGGAAAT
AACATCCCCGTTTTCTTCATCCAGGATGCTATCTTGTTCCCCGATCTCATTCACGCCGTCAAGCCCCGTGGCGAT
AGCGAGATCCCTCAGGCTGCTACCGCGCACGACTCGGCTTGGGACTTCTTCAGTCAGCAGCCTAGTGCACTTCAC
ACCCTTCTTTGGGCAATGGCTGGCCACGGTATTCCTCGGTCTTTCCGTCATGTTGATGGTTTCGGTGTGCACACC
TTCCGTCTAGTGACTGACGATGGAAAGACTAAGCTTGTCAAGTTCCACTGGAAGGGACTACAGGGCAAGGCTAGT
TTCGTGTGGGAGGAAGCACAGCAGACCGCTGGTAAAAATGCGGACTTTATGCGTCAGGATCTTTTCGAAGCTATC
GAAGCTGGACGTTTCCCCGAGTGGGAGCTTGGTGTTCAAATCATGGAGGAAGACGACCAGCTTCGGTTTGGGTTT
GATCTTTTGGATCCTACCAAGATTGTCCCAGAGGAACTCGTTCCTGTCACCAAGCTAGGCAAGATGCAACTGAAC
CGAAACCCCCTGAACTACTTTGCTGAAACTGAGCAAGTCATGTTCCAACCGGGCCATATCGTCCGCGGCGTCGAT
TTCACCGAGGACCCCCTCCTCCAAGGCCGTATCTTCTCCTACCTAGACACCCAACTCAACCGCCACGGCGGCCCC
AACTTCGAGCAGCTGCCCATCAACCGGCCCCGTGTACCAATCCACAACAACAACCGCGACGGAGCAGGCCAAATG
TTCATCCCCCTAAACCCAAACGCCTACTCCCCCAACACAGAAAACAACGGCTCCCCAAAACAAGCCAACCAAACC
GTAGGCAACGGCTTCTTCACCGCACCCGACCGCACATCAAGCGGCAAGCTCCAACGCACCGTCAGCTCTACCTTT
GAAGACGTCTGGTCCCAGCCACGCCTATTCTGGAACTCGCTCGTACCCGCCGAGAAGCAATTCATTGTAGACGCG
ATCCGATTCGAGACATCCAACGTCAAGAGCAGCGTCGTGCGCAACAACGTCATCATCCAGCTAAACCGCATCAGC
AACGACCTCGCGACGCGCGTCGCAAAGGCCATTGGCATTGATGCGCCAAAGCCAGATCCCACCTTTTACCACGAC
AACACGACCGCGCATATCGGCGCCTTCGGACAGAAACTCGCCAAACTAGATGGGCTGAAAGTTGGACTCCTTGCG
TCTGTCGATAAGCCGGCGTCTATTGCGCAGGGCGCGAAGCTGCAGTCTGCGCTTTCTGCCGTGGGCGTTGATGTC
GTGGTTGTTGCGGAGAGGTTTGCGGATGGTGTTAATCAGACGTATTCTGCGTCGGACGCAGTGCAGTTCGATGCT
GTTGTTGTCGCGGATGGTGCGGAGGGCCTGTTTGCCTCCAAGTCGATTACTAGCGTTCCGAACAAGGCTTCTGGT
GCGTCGTCTTTGTATCCCGCTGGTCGGCCTTTGGATATTCTGCTCGATGCTTTCCGGTTCGGGAAGACGGTTGGT
GCGCTCGGTAAGGGCTCGGCTGCGCTACGCTCTGCACTCATTTCTACGGACCGCGATGGTGTGTACACTGCTAGC
AATGCTGGGAGTGCCTTTGTCAAAGATATTAAGGAGGGACTTCGGACCTTCAAGTTCTTGGATCGGTTCGCGCTT
GATGAGTAG
Transcript >Pro_DTO070G2_2|g5666.t1
ATGCGTGTGCTTGCCCTCGTTACGGGTCTTGTTGGCATTGCCAATGCTGCCTGTCCTTATATGACTGGCGAAGCT
GGCCCCCTCGAGAGACGAGGTGATGGAGATGCTTCTTCCACCGAGGAATTTCTCTCCCAATTCTACCTCAAGGAC
CAAGATGTCTTTCTGACCTCCGATGTTGGCGGCCCGATCGAGGACCAAAACAGTCTCAGCGCAGGAGAGCGTGGA
GCCACCCTGCTTGAGGATTTCATTTTCCGCCAGAAGATCCAACGCTTCGACCATGAACGGGTACCGGAACGCGCC
GTTCATGCTCGAGGCGCCGGCGCCCACGGAACATTCACCTCGTACGGCGACTGGTCCAACCTGACTGCCGCGTCT
TTCCTTTCTGCCAAAGGCAAACAAACCCCGATGTTCACGCGCTTCTCTACTGTTGCTGGCAGTCGCGGAAGCGCC
GATACTGCGCGAGATGTCCACGGCTTTGCGACTCGCTTCTATACTGATGAAGGGAACTTCGATATTGTTGGAAAT
AACATCCCCGTTTTCTTCATCCAGGATGCTATCTTGTTCCCCGATCTCATTCACGCCGTCAAGCCCCGTGGCGAT
AGCGAGATCCCTCAGGCTGCTACCGCGCACGACTCGGCTTGGGACTTCTTCAGTCAGCAGCCTAGTGCACTTCAC
ACCCTTCTTTGGGCAATGGCTGGCCACGGTATTCCTCGGTCTTTCCGTCATGTTGATGGTTTCGGTGTGCACACC
TTCCGTCTAGTGACTGACGATGGAAAGACTAAGCTTGTCAAGTTCCACTGGAAGGGACTACAGGGCAAGGCTAGT
TTCGTGTGGGAGGAAGCACAGCAGACCGCTGGTAAAAATGCGGACTTTATGCGTCAGGATCTTTTCGAAGCTATC
GAAGCTGGACGTTTCCCCGAGTGGGAGCTTGGTGTTCAAATCATGGAGGAAGACGACCAGCTTCGGTTTGGGTTT
GATCTTTTGGATCCTACCAAGATTGTCCCAGAGGAACTCGTTCCTGTCACCAAGCTAGGCAAGATGCAACTGAAC
CGAAACCCCCTGAACTACTTTGCTGAAACTGAGCAAGTCATGTTCCAACCGGGCCATATCGTCCGCGGCGTCGAT
TTCACCGAGGACCCCCTCCTCCAAGGCCGTATCTTCTCCTACCTAGACACCCAACTCAACCGCCACGGCGGCCCC
AACTTCGAGCAGCTGCCCATCAACCGGCCCCGTGTACCAATCCACAACAACAACCGCGACGGAGCAGGCCAAATG
TTCATCCCCCTAAACCCAAACGCCTACTCCCCCAACACAGAAAACAACGGCTCCCCAAAACAAGCCAACCAAACC
GTAGGCAACGGCTTCTTCACCGCACCCGACCGCACATCAAGCGGCAAGCTCCAACGCACCGTCAGCTCTACCTTT
GAAGACGTCTGGTCCCAGCCACGCCTATTCTGGAACTCGCTCGTACCCGCCGAGAAGCAATTCATTGTAGACGCG
ATCCGATTCGAGACATCCAACGTCAAGAGCAGCGTCGTGCGCAACAACGTCATCATCCAGCTAAACCGCATCAGC
AACGACCTCGCGACGCGCGTCGCAAAGGCCATTGGCATTGATGCGCCAAAGCCAGATCCCACCTTTTACCACGAC
AACACGACCGCGCATATCGGCGCCTTCGGACAGAAACTCGCCAAACTAGATGGGCTGAAAGTTGGACTCCTTGCG
TCTGTCGATAAGCCGGCGTCTATTGCGCAGGGCGCGAAGCTGCAGTCTGCGCTTTCTGCCGTGGGCGTTGATGTC
GTGGTTGTTGCGGAGAGGTTTGCGGATGGTGTTAATCAGACGTATTCTGCGTCGGACGCAGTGCAGTTCGATGCT
GTTGTTGTCGCGGATGGTGCGGAGGGCCTGTTTGCCTCCAAGTCGATTACTAGCGTTCCGAACAAGGCTTCTGGT
GCGTCGTCTTTGTATCCCGCTGGTCGGCCTTTGGATATTCTGCTCGATGCTTTCCGGTTCGGGAAGACGGTTGGT
GCGCTCGGTAAGGGCTCGGCTGCGCTACGCTCTGCACTCATTTCTACGGACCGCGATGGTGTGTACACTGCTAGC
AATGCTGGGAGTGCCTTTGTCAAAGATATTAAGGAGGGACTTCGGACCTTCAAGTTCTTGGATCGGTTCGCGCTT
GATGAGTAG
Gene >Pro_DTO070G2_2|g5666.t1
ATGCGTGTGCTTGCCCTCGTTACGGGTCTTGTTGGCATTGCCAATGCTGCCTGTCCTTATATGACTGGCGAAGCT
GGCCCCCTCGAGAGACGAGGTGATGGAGATGCTTCTTCCACCGAGGAATTTCTCTCCCAATTCTACCTCAAGGAC
CAAGATGTCTTTCTGACCTCCGATGTTGGCGGCCCGATCGAGGACCAAAACAGTCTCAGCGCAGGAGAGCGTGGA
GCCACCCTGCTTGAGGATTTCATTTTCCGCCAGAAGATCCAACGCTTCGACCATGAACGGGTATGTGTTCCACGT
TTTAATTGAAGTTCCAACGCTCATATCTGTTTTTCAAGGTACCGGAACGCGCCGTTCATGCTCGAGGCGCCGGCG
CCCACGGAACATTCACCTCGTACGGCGACTGGTCCAACCTGACTGCCGCGTCTTTCCTTTCTGCCAAAGGCAAAC
AAACCCCGATGTTCACGCGCTTCTCTACTGTTGCTGGCAGTCGCGGAAGCGCCGATACTGCGCGAGATGTCCACG
GCTTTGCGACTCGCTTCTATACTGATGAAGGGAACTTCGGTACGGCAGATCTTTTTTTGACGAAAGTACACAACT
GATTTGGATCTAGATATTGTTGGAAATAACATCCCCGTTTTCTTCATCCAGGATGCTATCTTGTTCCCCGATCTC
ATTCACGCCGTCAAGCCCCGTGGCGATAGCGAGATCCCTCAGGCTGCTACCGCGCACGACTCGGCTTGGGACTTC
TTCAGTCAGCAGCCTAGTGCACTTCACACCCTTCTTTGGGCAATGGCTGGCCACGGTATTCCTCGGTCTTTCCGT
CATGTTGATGGTTTCGGTGTGCACACCTTCCGTCTAGTGACTGACGATGGAAAGACTAAGCTTGTCAAGTTCCAC
TGGAAGGGACTACAGGGCAAGGCTAGTTTCGTGTGGGAGGAAGCACAGCAGACCGCTGGTAAAAATGCGGACTTT
ATGCGTCAGGATCTTTTCGAAGCTATCGAAGCTGGACGTTTCCCCGAGTGGGAGGTAGGTGATAACCCCATATCC
ATCGCAATTCTTGCTAATTTTTTGCTAGCTTGGTGTTCAAATCATGGAGGAAGACGACCAGCTTCGGTTTGGGTT
TGATCTTTTGGATCCTACCAAGATTGTCCCAGAGGAACTCGTTCCTGTCACCAAGCTAGGCAAGATGCAACTGAA
CCGAAACCCCCTGAACTACTTTGCTGAAACTGAGCAAGTCATGGTACGTCCCAACCTATCATCACCACTTGCAAT
ACTAATTTCTTAGTTCCAACCGGGCCATATCGTCCGCGGCGTCGATTTCACCGAGGACCCCCTCCTCCAAGGCCG
TATCTTCTCCTACCTAGACACCCAACTCAACCGCCACGGCGGCCCCAACTTCGAGCAGCTGCCCATCAACCGGCC
CCGTGTACCAATCCACAACAACAACCGCGACGGAGCAGGTACGTCCCACCACCAAACCCACCCCATCTTCCAATC
CCTCTTTCTAACAAACCCCAGGCCAAATGTTCATCCCCCTAAACCCAAACGCCTACTCCCCCAACACAGAAAACA
ACGGCTCCCCAAAACAAGCCAACCAAACCGTAGGCAACGGCTTCTTCACCGCACCCGACCGCACATCAAGCGGCA
AGCTCCAACGCACCGTCAGCTCTACCTTTGAAGACGTCTGGTCCCAGCCACGCCTATTCTGGAACTCGCTCGTAC
CCGCCGAGAAGCAATTCATTGTAGACGCGATCCGATTCGAGACATCCAACGTCAAGAGCAGCGTCGTGCGCAACA
ACGTCATCATCCAGCTAAACCGCATCAGCAACGACCTCGCGACGCGCGTCGCAAAGGCCATTGGCATTGATGCGC
CAAAGCCAGATCCCACCTTTTACCACGACAACACGACCGCGCATATCGGCGCCTTCGGACAGAAACTCGCCAAAC
TAGATGGGCTGAAAGTTGGACTCCTTGCGTCTGTCGATAAGCCGGCGTCTATTGCGCAGGGCGCGAAGCTGCAGT
CTGCGCTTTCTGCCGTGGGCGTTGATGTCGTGGTTGTTGCGGAGAGGTTTGCGGATGGTGTTAATCAGACGTATT
CTGCGTCGGACGCAGTGCAGTTCGATGCTGTTGTTGTCGCGGATGGTGCGGAGGGCCTGTTTGCCTCCAAGTCGA
TTACTAGCGTTCCGAACAAGGCTTCTGGTGCGTCGTCTTTGTATCCCGCTGGTCGGCCTTTGGATATTCTGCTCG
ATGCTTTCCGGTTCGGGAAGACGGTTGGTGCGCTCGGTAAGGGCTCGGCTGCGCTACGCTCTGCACTCATTTCTA
CGGACCGCGATGGTGTGTACACTGCTAGCAATGCTGGGAGTGCCTTTGTCAAAGATATTAAGGAGGGACTTCGGA
CCTTCAAGTTCTTGGATCGGTTCGCGCTTGATGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail