Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g5647.t1
Gene name
Locationscaffold_07:614601..616750
Strand-
Gene length (bp)2149
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09284 RhgB_N Rhamnogalacturonan lyase B, N-terminal 2.9E-109 23 271
PF14683 CBM-like Polysaccharide lyase family 4, domain III 4.2E-42 362 527
PF14686 fn3_3 Polysaccharide lyase family 4, domain II 2.2E-22 277 350

GO

GO Term Description Terminal node
GO:0016837 carbon-oxygen lyase activity, acting on polysaccharides Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030246 carbohydrate binding Yes
GO:0016829 lyase activity No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0016835 carbon-oxygen lyase activity No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g5647.t1
MMFFKSLAIASLALWAKQASAAFGITTSTASYVIDAGSTNPLKFTVSRTNCDITSINYYGSELQYQSTGSHIGSG
LGSATVSATQSGDYIKVTCETSTLTHYYVVHNGDSTIHMATYTTAEPTIGELRYIARLNSALLPNEEPFGVVSNI
AGGTVVEGEDVFLVSGQTRSKFYSSERFIDDHIHCVSGSAHRVCMILNQYETSAGGPFHRDINTNNVGSYTGLYW
YMNSGHVQTETYRQGLHGPYSMVFSRSGTPSSTLDTSFFADLSIKGYVATSARGYVTGTATGADSTFKWVVHWYN
SAAQYWTYTSSSGAFTSPAMKPGTYTMVYYQGEYVVATSSVTVTAGSTTSKSISGSVKTGTTVFRIGDWDGTPNG
FLNAANQLRMHPSDTRMSSWSPTTYTVGSSQVSSFPMALFKSVNSPLTIKFTASSSQTGAATLRIGTTLSFASGR
PQVVFNSYSGATPAAPTNLNSRGVTRGAYRGFGEVYDVSIPAGTIVAGTNTITISVASGSSGDTYLSPNFIFDCV
ELFQ*
Coding >Pro_DTO070G2_2|g5647.t1
ATGATGTTTTTCAAGTCCTTGGCCATTGCTTCGCTAGCACTTTGGGCTAAGCAGGCATCCGCGGCCTTCGGAATC
ACTACTAGCACTGCTTCCTATGTGATTGATGCTGGCTCTACAAACCCGCTTAAATTTACCGTCAGCCGGACAAAC
TGTGACATTACTTCGATCAATTACTATGGATCCGAGCTTCAATACCAGTCGACTGGATCTCATATCGGATCGGGT
CTTGGTAGCGCAACTGTGTCTGCCACGCAGAGTGGCGACTACATCAAGGTGACCTGCGAAACATCCACCTTGACA
CACTACTATGTTGTCCACAACGGAGATTCGACCATCCACATGGCGACATACACAACCGCAGAACCTACTATTGGA
GAACTTCGATATATCGCGCGCCTGAATTCAGCCCTGCTGCCGAATGAAGAGCCATTCGGTGTTGTCTCTAATATT
GCAGGTGGCACTGTCGTCGAGGGAGAGGATGTGTTCTTGGTTAGTGGACAAACGCGAAGCAAGTTCTACTCGAGC
GAACGGTTTATTGATGACCACATCCACTGTGTCTCTGGAAGCGCGCACCGTGTCTGCATGATCTTAAATCAATAT
GAGACATCTGCTGGCGGACCTTTCCATCGTGATATCAACACCAACAATGTTGGTTCTTATACTGGCCTATACTGG
TACATGAACTCCGGACACGTTCAGACCGAGACCTACCGCCAGGGCCTGCACGGCCCATACTCGATGGTCTTCAGC
CGAAGCGGTACCCCCAGTTCCACCCTTGACACGTCGTTCTTTGCCGATCTCAGTATCAAGGGATACGTCGCCACA
TCTGCGAGAGGCTATGTTACGGGTACTGCAACCGGGGCTGACTCGACTTTCAAATGGGTGGTTCACTGGTATAAC
TCCGCCGCACAGTACTGGACCTACACTTCGTCTTCCGGAGCTTTCACCTCCCCTGCTATGAAGCCCGGCACTTAC
ACCATGGTATACTACCAGGGCGAATATGTCGTTGCCACCTCGTCAGTGACTGTTACTGCCGGATCAACCACATCG
AAGAGTATCTCCGGGTCTGTGAAGACCGGAACGACAGTCTTCAGGATTGGAGACTGGGATGGAACACCGAACGGC
TTCCTCAACGCGGCCAACCAGCTCCGTATGCATCCCTCCGATACCCGCATGTCTTCCTGGTCCCCGACCACCTAC
ACAGTCGGCAGCTCTCAAGTCTCTTCTTTCCCCATGGCCCTCTTCAAATCGGTCAATTCACCTTTGACGATTAAA
TTCACGGCATCATCTTCGCAGACCGGAGCTGCGACGCTGAGAATTGGCACAACCCTCTCCTTTGCGTCTGGCCGG
CCCCAGGTTGTGTTCAACAGCTATTCCGGCGCCACCCCGGCTGCCCCGACTAACCTCAACTCCCGTGGCGTCACT
CGCGGTGCGTATAGAGGGTTTGGCGAGGTTTACGACGTTTCGATACCGGCTGGAACTATCGTCGCTGGAACTAAC
ACTATCACCATCAGCGTTGCTTCTGGTAGCTCTGGAGACACTTACCTGAGCCCGAACTTTATCTTCGATTGCGTG
GAGCTCTTCCAGTAA
Transcript >Pro_DTO070G2_2|g5647.t1
ATGATGTTTTTCAAGTCCTTGGCCATTGCTTCGCTAGCACTTTGGGCTAAGCAGGCATCCGCGGCCTTCGGAATC
ACTACTAGCACTGCTTCCTATGTGATTGATGCTGGCTCTACAAACCCGCTTAAATTTACCGTCAGCCGGACAAAC
TGTGACATTACTTCGATCAATTACTATGGATCCGAGCTTCAATACCAGTCGACTGGATCTCATATCGGATCGGGT
CTTGGTAGCGCAACTGTGTCTGCCACGCAGAGTGGCGACTACATCAAGGTGACCTGCGAAACATCCACCTTGACA
CACTACTATGTTGTCCACAACGGAGATTCGACCATCCACATGGCGACATACACAACCGCAGAACCTACTATTGGA
GAACTTCGATATATCGCGCGCCTGAATTCAGCCCTGCTGCCGAATGAAGAGCCATTCGGTGTTGTCTCTAATATT
GCAGGTGGCACTGTCGTCGAGGGAGAGGATGTGTTCTTGGTTAGTGGACAAACGCGAAGCAAGTTCTACTCGAGC
GAACGGTTTATTGATGACCACATCCACTGTGTCTCTGGAAGCGCGCACCGTGTCTGCATGATCTTAAATCAATAT
GAGACATCTGCTGGCGGACCTTTCCATCGTGATATCAACACCAACAATGTTGGTTCTTATACTGGCCTATACTGG
TACATGAACTCCGGACACGTTCAGACCGAGACCTACCGCCAGGGCCTGCACGGCCCATACTCGATGGTCTTCAGC
CGAAGCGGTACCCCCAGTTCCACCCTTGACACGTCGTTCTTTGCCGATCTCAGTATCAAGGGATACGTCGCCACA
TCTGCGAGAGGCTATGTTACGGGTACTGCAACCGGGGCTGACTCGACTTTCAAATGGGTGGTTCACTGGTATAAC
TCCGCCGCACAGTACTGGACCTACACTTCGTCTTCCGGAGCTTTCACCTCCCCTGCTATGAAGCCCGGCACTTAC
ACCATGGTATACTACCAGGGCGAATATGTCGTTGCCACCTCGTCAGTGACTGTTACTGCCGGATCAACCACATCG
AAGAGTATCTCCGGGTCTGTGAAGACCGGAACGACAGTCTTCAGGATTGGAGACTGGGATGGAACACCGAACGGC
TTCCTCAACGCGGCCAACCAGCTCCGTATGCATCCCTCCGATACCCGCATGTCTTCCTGGTCCCCGACCACCTAC
ACAGTCGGCAGCTCTCAAGTCTCTTCTTTCCCCATGGCCCTCTTCAAATCGGTCAATTCACCTTTGACGATTAAA
TTCACGGCATCATCTTCGCAGACCGGAGCTGCGACGCTGAGAATTGGCACAACCCTCTCCTTTGCGTCTGGCCGG
CCCCAGGTTGTGTTCAACAGCTATTCCGGCGCCACCCCGGCTGCCCCGACTAACCTCAACTCCCGTGGCGTCACT
CGCGGTGCGTATAGAGGGTTTGGCGAGGTTTACGACGTTTCGATACCGGCTGGAACTATCGTCGCTGGAACTAAC
ACTATCACCATCAGCGTTGCTTCTGGTAGCTCTGGAGACACTTACCTGAGCCCGAACTTTATCTTCGATTGCGTG
GAGCTCTTCCAGTAA
Gene >Pro_DTO070G2_2|g5647.t1
ATGATGTTTTTCAAGTCCTTGGCCATTGCTTCGCTAGCACTTTGGGCTAAGCAGGCATCCGCGGCCTTCGGAATC
ACTACTAGCACTGCTTCCTATGTGATTGATGCTGGCTCTACAAACCCGCTTAAATTTACCGTCAGCCGGACAAAC
TGTGACATTACTTCGATCAATTACTATGGATCCGAGCTTCAATACCAGTCGACTGGATCTCATATCGGATCGGGT
CTTGGTAGCGCAACTGTGTCTGCCACGCAGAGTGGTGAGTTGAGAAACAAGACGTCTGTTGGAAAATATTCTGAT
CAGTATAGGCGACTACATCAAGGTGACCTGCGAAACATCCACCTTGACACACTACTATGTTGTCCACAACGGAGA
TTCGACCATCCACATGGCGACATACACAACCGCAGGTTAGTGTTGTTCGTGCGCAAATGTGTTTTTTATACTCAT
TATAATCAGAACCTACTATTGGAGAACTTCGATATATCGCGCGCCTGAATTCAGCCCTGCTGCCGAATGAAGAGC
CATTCGGTGTTGTCTCTAATATTGCAGGTGGCACTGTCGTCGAGGGAGAGGATGTGGTACGTTTTTTTCTGAAGC
TTTTTTTCAATACAAACAGCTGACACATATTAGTTCTTGGTTAGTGGACAAACGCGAAGCAAGTTCTACTCGAGC
GAACGGTTTATTGATGACCACATCCACTGTAAGAATACCTCTACCCTGGCCGATGCGAGTCGATTTAACATAAAC
AGGTGTCTCTGGAAGCGCGCACCGTGTCTGCATGATCTTAAATCAATATGAGACATCTGCTGGCGGACCTTTCCA
TCGGTAAGCTCCTCGTACAGCATGACTTGATCCAGACTAACATGCACCAGTGATATCAACACCAACAATGTTGGT
TCTTATACTGGCCTATACTGGTACATGGTATGTGGAAACTGTCGCTCAATCAATAACTGCCTCTTACTCTATACA
GAACTCCGGACACGTTCAGACCGAGACCTACCGCCAGGGCCTGCACGGCCCATACTCGATGGTCTTCAGCCGAAG
CGGTACCCCCAGTTCCACCCTTGACACGTCGTTCTTTGCCGATCTCAGTATCAAGGGATACGTCGCCACATCTGC
GAGAGGCTATGTTACGGGTACTGCAACCGGGGCTGACTCGACTTTCAAATGGGTGGTTCACTGGTAGGTCCAATG
CAATACCTGGATGAGTACATATCTAACTCCAAGACAGGTATAACTCCGCCGCACAGTACTGGACCTACACTTCGT
CTTCCGGAGCTTTCACCTCCCCTGCTATGAAGCCCGGCACTTACACCATGGTATACTACCAGGGCGAATATGTCG
TTGCCACCTCGTCAGTGACTGTTACTGCCGGATCAACCACATCGAAGAGTATCTCCGGGTCTGTGAAGACCGGAA
CGACAGTCTTCAGGATTGGAGACTGGGATGGAACGTAAGTTCATTGATTTTAACCCACATAATTGTTCCGATATT
GACTGCCCATAGACCGAACGGCTTCCTCAACGCGGCCAACCAGCTCCGTATGCATCCCTCCGATACCCGCATGTC
TTCCTGGTCCCCGACCACCTACACAGTCGGCAGCTCTCAAGTCTCTTCTTTCCCCATGGCCCTCTTCAAATCGGT
CAATTCACCTTTGACGATTAAATTCACGGCATCATCTTCGCAGACCGGAGCTGCGACGCTGAGAATTGGCACAAC
CCTCTCCTTTGCGTCTGGCCGGCCCCAGGTTGTGGTATGTTCAAGCACATTCACTTTCTACACTCTTAGCATGTA
TCTAACTTTTACACAGTTCAACAGCTATTCCGGCGCCACCCCGGCTGCCCCGACTAACCTCAACTCCCGTGGCGT
CACTCGCGGTGCGTATAGAGGGTTTGGCGAGGTTTACGACGTTTCGATACCGGCTGGAACTATCGTCGCTGGAAC
TAACACTGTAAGGACTTTTGAGCCCAGTCAGATGATATGATGCTAATCCGGCCTAGATCACCATCAGCGTTGCTT
CTGGTAGCTCTGGAGACACTTACCTGAGCCCGAACTTTGTGAGTATCTTTCTGGTTATCTGGTCTTTCCGATGTA
AGCTTACCTGTCTCAATAGATCTTCGATTGCGTGGAGCTCTTCCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail