Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g5544.t1
Gene name
Locationscaffold_07:373313..378600
Strand+
Gene length (bp)5287
Transcript length (bp)3960
Coding sequence length (bp)3960
Protein length (aa) 1320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01301 Glyco_hydro_35 Glycosyl hydrolases family 35 1.1E-80 375 708
PF13364 BetaGal_dom4_5 Beta-galactosidase jelly roll domain 1.3E-23 1003 1115
PF13364 BetaGal_dom4_5 Beta-galactosidase jelly roll domain 1.8E-30 1168 1278
PF10435 BetaGal_dom2 Beta-galactosidase, domain 2 1.2E-55 720 895
PF05368 NmrA NmrA-like family 9.0E-28 5 229
PF13363 BetaGal_dom3 Beta-galactosidase, domain 3 4.1E-22 898 971
PF13460 NAD_binding_10 NAD(P)H-binding 2.5E-08 9 147

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g5544.t1
MSRLIVILGITGVQGSSVADAYLVNPGWKIRGVTRNPASDTAKKWEMKGVEMIKGDLDDVASLSEAFVGADIIFG
VTDFWTIFKDPESHQKKKPGQSLVEYCHDVELQQGKNIADAAATVPGLSRYIFSSMAHAKNSSNSKFTELYHMDS
KADAAIYAQSIPALAGKFSQVQAPIYFQLPWEWGLPTTPKKVVDGTWRMTGIGPGDKGIPFGHVRKDFGPCVRAV
AESEPNVNLFAVGEYVSWSDYLRIFCETQGFKYGGYDELSYDKFCELLPGGLGHEFAHNVLFAHEFGYEGIDPAV
VRPEKLGLKMTSFREYCQETDFSALDGDKWRVPVQPPIMRLLTILPILLGLISSHFVSATDNGKTTDVTWDQYSL
SVKGERVYVFSGEFHYQRLPVPELWLDVFQKLRANGFNAISIYFFWNFHSASEDTFDFENGAHDVQRVFDYAKQA
GLYVIARAGPYCNAETSAGGFALWASNGQMGSTRTSASTYYDRWYPWIQKIGKIIAANQITSGGPVILNQHENEL
QETTHSANNTVVKYMEQVKAAFNEAGIVVPSTHNEKGMRSMSWSTDYQDVGGAVNVYGLDSYPGGLSCTNPDTGF
NLVRTYYQWFQNYSSSQPEYLPEFEGGWFSPWGGTFYDQCSTELSPEFADVYYKNNIGSRVTLQNIYMVMGATSW
GHSAAPVVYTSYDYSAPMRETREIRDKLKQTKLIGLFTRVSSGLLQMQMEGNGTGYTSDAGIYTWALRNPETQAG
FYVLAHSTSSSRAVTTTSLNVNTSAGALTIPNIELAGRQSKIIVTDYRIGQGSSLLYSSAEVLTYATLDIDVIVF
YLNIGQKGEFVFKDAPTHLTFQTYGNSKVNSGASNHGTKYTYTQGDGTTVLKFSHGVLVYLLDKETAWNFFAVPT
TSNPIVVPSEQIIALGPYLVRTATVSGDTVSLVGDNANTTSIEVYTGNSKVTKIKWNGKEISTKKTPYGSLIGSA
PGAQAKVSLPTLKSWKAQDTLPEIKADYDDSRWTICNKTRSVNSVAPLTLPVLYSGDYGYHAGTKIYRGRFDGVT
ATGANLTVQNGAAAGWAAWLNGVYVGGAIGDPTLAATSAELLFNSATLRKTDNVLTVIMDYTGHDEANVSPNGAQ
NPRGILGATLLGGEFTSWRIQGNAGGEANIDPVRGPMNEGGLYGERLGWHLPGYKAPKTATSHSPLDGISGAAGR
FYTTTFQLDLDSDLDVPIGLQLDASADFPAVVQIFMNGYQFGHYLPHIGPQTRFPFPPGVINNRGENTLAMSLWA
LTDRGARLSQVDLVAYGAYRTGFNFNHDWSYLQPQWKNNREQYV*
Coding >Pro_DTO070G2_2|g5544.t1
ATGTCGCGACTTATTGTGATCCTCGGTATTACGGGTGTGCAAGGAAGCTCCGTCGCCGACGCTTACCTTGTGAAT
CCGGGCTGGAAGATTCGCGGTGTGACGCGCAATCCGGCATCTGATACTGCAAAGAAATGGGAGATGAAAGGTGTT
GAAATGATCAAAGGTGACCTTGATGATGTGGCATCCTTGAGCGAGGCCTTTGTGGGAGCCGACATTATTTTTGGT
GTCACCGACTTCTGGACAATCTTCAAAGATCCAGAAAGTCACCAGAAGAAGAAGCCCGGCCAATCACTTGTGGAA
TATTGCCACGATGTCGAGCTCCAACAGGGCAAGAATATTGCCGATGCTGCGGCCACTGTTCCTGGCCTATCCCGA
TACATCTTCAGCTCAATGGCCCATGCGAAGAATTCCAGTAACAGCAAGTTCACCGAACTTTATCACATGGATTCT
AAAGCAGACGCTGCCATCTACGCACAGAGCATCCCGGCCCTGGCTGGAAAATTCTCGCAGGTTCAGGCGCCCATA
TATTTCCAGCTCCCTTGGGAGTGGGGACTTCCTACAACCCCGAAGAAGGTAGTTGATGGCACCTGGCGAATGACA
GGAATTGGCCCAGGTGACAAGGGCATTCCGTTCGGGCATGTCCGCAAGGATTTCGGCCCTTGCGTCAGGGCAGTT
GCAGAGTCCGAGCCCAATGTCAATTTATTTGCTGTTGGTGAATATGTATCGTGGTCAGATTACCTCCGGATCTTT
TGCGAAACCCAAGGTTTCAAGTATGGTGGCTATGACGAGCTTTCCTACGATAAATTCTGCGAGTTGCTTCCCGGA
GGTCTTGGTCACGAATTTGCTCACAATGTATTATTTGCACATGAGTTCGGGTACGAAGGTATCGATCCTGCTGTT
GTACGACCAGAGAAGCTTGGTCTGAAAATGACCTCGTTCCGTGAATATTGCCAAGAGACTGATTTCTCGGCACTG
GACGGTGACAAATGGAGAGTACCTGTGCAGCCCCCAATAATGCGTCTTCTCACGATTCTCCCTATACTCCTTGGA
CTCATATCCAGCCATTTCGTCTCTGCGACAGATAATGGCAAGACTACTGATGTGACATGGGATCAATACAGCCTC
TCAGTTAAAGGAGAGAGGGTATATGTGTTCTCTGGTGAATTCCACTACCAGCGACTCCCCGTGCCGGAGCTTTGG
CTCGACGTATTTCAGAAGCTACGCGCAAATGGATTCAATGCGATTTCTATCTACTTCTTCTGGAATTTCCACTCC
GCTTCCGAAGATACTTTCGACTTCGAGAACGGTGCCCACGACGTCCAGCGCGTCTTTGATTATGCCAAGCAGGCA
GGTCTGTATGTGATTGCGCGCGCGGGACCTTACTGCAATGCTGAGACCTCTGCTGGTGGTTTCGCACTGTGGGCA
TCCAATGGGCAAATGGGCAGCACGCGCACGAGCGCAAGCACCTACTATGACCGATGGTATCCGTGGATCCAGAAG
ATCGGAAAGATCATCGCCGCAAACCAAATCACAAGCGGTGGTCCGGTCATTCTCAATCAGCACGAGAATGAGTTG
CAGGAGACAACACACAGTGCCAATAACACTGTTGTCAAGTACATGGAACAAGTTAAAGCCGCCTTCAATGAGGCT
GGTATCGTTGTCCCGAGCACGCATAATGAGAAGGGAATGCGCTCTATGAGCTGGTCGACGGACTACCAGGATGTG
GGTGGTGCCGTCAATGTCTATGGTTTGGACTCCTATCCTGGTGGTCTGTCCTGTACCAATCCAGATACTGGGTTC
AATCTCGTCCGCACTTATTACCAATGGTTCCAGAATTACTCGAGTTCTCAGCCCGAGTATCTGCCGGAGTTTGAG
GGCGGTTGGTTCTCCCCCTGGGGAGGGACGTTCTACGATCAATGTTCTACCGAGCTTTCGCCTGAATTCGCCGAT
GTCTACTATAAGAATAATATCGGCTCCAGAGTCACATTGCAGAATATATATATGGTGATGGGGGCAACTTCTTGG
GGCCACAGTGCTGCTCCGGTTGTCTATACTTCATATGACTACTCTGCGCCCATGCGAGAGACGCGTGAGATTCGG
GACAAACTCAAGCAGACCAAGTTGATCGGTCTGTTTACGCGCGTGTCATCTGGTCTTTTACAAATGCAAATGGAA
GGGAATGGAACAGGGTACACCAGTGATGCGGGTATATATACGTGGGCCTTGCGAAACCCAGAAACCCAAGCCGGT
TTCTATGTTCTCGCGCACTCTACCAGCTCATCTCGTGCTGTGACCACTACTTCACTTAATGTCAATACATCGGCT
GGGGCCCTGACAATCCCTAATATTGAGTTGGCCGGCCGTCAGAGCAAAATTATCGTCACTGACTACCGGATTGGC
CAGGGCTCGAGCTTGCTCTATTCATCCGCCGAGGTCTTGACCTACGCCACCCTCGACATAGATGTTATTGTCTTC
TATCTGAATATCGGACAAAAAGGAGAGTTTGTATTCAAAGACGCACCGACCCATCTGACTTTCCAAACTTACGGG
AATTCGAAAGTCAACTCTGGTGCATCGAATCATGGCACGAAATACACATACACTCAAGGGGATGGCACGACAGTG
CTGAAATTCTCGCACGGCGTACTGGTCTACCTTCTTGATAAGGAGACAGCGTGGAACTTCTTTGCAGTACCGACT
ACTTCCAATCCGATTGTGGTTCCCAGTGAGCAGATCATTGCCCTTGGGCCATATCTCGTTCGCACAGCGACTGTC
AGTGGGGATACTGTCAGTCTTGTTGGTGACAACGCAAACACAACATCTATTGAGGTCTACACGGGCAACTCAAAG
GTGACCAAAATCAAGTGGAATGGCAAAGAGATCTCAACCAAGAAGACACCATACGGCAGCTTAATCGGATCAGCC
CCGGGAGCCCAAGCCAAAGTATCGCTGCCGACTCTGAAATCATGGAAAGCGCAAGATACCCTTCCGGAGATTAAG
GCAGACTACGATGATTCTCGCTGGACCATCTGCAACAAAACGAGATCAGTCAACTCTGTGGCACCACTCACACTT
CCCGTGCTTTACTCTGGCGACTACGGCTACCATGCCGGAACGAAAATATATCGCGGACGGTTCGATGGCGTGACC
GCGACAGGCGCAAATCTCACTGTCCAGAACGGCGCAGCCGCTGGTTGGGCCGCCTGGCTAAACGGAGTCTACGTT
GGCGGAGCCATTGGTGATCCGACCCTAGCCGCGACATCAGCCGAGCTACTATTCAACAGCGCTACCTTGCGCAAG
ACAGACAATGTTCTGACCGTTATCATGGATTACACAGGCCACGACGAGGCGAACGTGTCGCCAAACGGAGCACAA
AACCCGCGTGGTATACTAGGCGCGACGCTTCTTGGTGGCGAATTCACTTCCTGGCGCATCCAAGGCAATGCAGGA
GGCGAAGCCAACATCGATCCCGTCCGGGGACCCATGAACGAAGGGGGTCTCTATGGAGAGCGTCTCGGTTGGCAT
CTCCCAGGATACAAAGCGCCCAAGACCGCAACCTCGCACAGTCCGCTGGACGGCATATCTGGTGCAGCAGGCCGG
TTCTACACGACGACGTTCCAGCTCGACCTGGACTCCGACCTGGACGTTCCGATTGGTCTGCAGCTCGATGCATCT
GCTGATTTCCCCGCAGTAGTCCAGATCTTCATGAATGGGTACCAGTTCGGTCATTACCTGCCACACATCGGTCCC
CAGACTAGGTTCCCTTTTCCACCTGGCGTGATCAATAACCGTGGGGAGAACACGTTGGCGATGAGTCTGTGGGCG
CTGACGGACCGAGGGGCGAGACTGAGTCAGGTGGATCTGGTTGCATATGGGGCTTATCGTACAGGATTCAACTTC
AATCACGATTGGTCATACCTGCAGCCACAATGGAAGAACAACCGGGAGCAATATGTGTAG
Transcript >Pro_DTO070G2_2|g5544.t1
ATGTCGCGACTTATTGTGATCCTCGGTATTACGGGTGTGCAAGGAAGCTCCGTCGCCGACGCTTACCTTGTGAAT
CCGGGCTGGAAGATTCGCGGTGTGACGCGCAATCCGGCATCTGATACTGCAAAGAAATGGGAGATGAAAGGTGTT
GAAATGATCAAAGGTGACCTTGATGATGTGGCATCCTTGAGCGAGGCCTTTGTGGGAGCCGACATTATTTTTGGT
GTCACCGACTTCTGGACAATCTTCAAAGATCCAGAAAGTCACCAGAAGAAGAAGCCCGGCCAATCACTTGTGGAA
TATTGCCACGATGTCGAGCTCCAACAGGGCAAGAATATTGCCGATGCTGCGGCCACTGTTCCTGGCCTATCCCGA
TACATCTTCAGCTCAATGGCCCATGCGAAGAATTCCAGTAACAGCAAGTTCACCGAACTTTATCACATGGATTCT
AAAGCAGACGCTGCCATCTACGCACAGAGCATCCCGGCCCTGGCTGGAAAATTCTCGCAGGTTCAGGCGCCCATA
TATTTCCAGCTCCCTTGGGAGTGGGGACTTCCTACAACCCCGAAGAAGGTAGTTGATGGCACCTGGCGAATGACA
GGAATTGGCCCAGGTGACAAGGGCATTCCGTTCGGGCATGTCCGCAAGGATTTCGGCCCTTGCGTCAGGGCAGTT
GCAGAGTCCGAGCCCAATGTCAATTTATTTGCTGTTGGTGAATATGTATCGTGGTCAGATTACCTCCGGATCTTT
TGCGAAACCCAAGGTTTCAAGTATGGTGGCTATGACGAGCTTTCCTACGATAAATTCTGCGAGTTGCTTCCCGGA
GGTCTTGGTCACGAATTTGCTCACAATGTATTATTTGCACATGAGTTCGGGTACGAAGGTATCGATCCTGCTGTT
GTACGACCAGAGAAGCTTGGTCTGAAAATGACCTCGTTCCGTGAATATTGCCAAGAGACTGATTTCTCGGCACTG
GACGGTGACAAATGGAGAGTACCTGTGCAGCCCCCAATAATGCGTCTTCTCACGATTCTCCCTATACTCCTTGGA
CTCATATCCAGCCATTTCGTCTCTGCGACAGATAATGGCAAGACTACTGATGTGACATGGGATCAATACAGCCTC
TCAGTTAAAGGAGAGAGGGTATATGTGTTCTCTGGTGAATTCCACTACCAGCGACTCCCCGTGCCGGAGCTTTGG
CTCGACGTATTTCAGAAGCTACGCGCAAATGGATTCAATGCGATTTCTATCTACTTCTTCTGGAATTTCCACTCC
GCTTCCGAAGATACTTTCGACTTCGAGAACGGTGCCCACGACGTCCAGCGCGTCTTTGATTATGCCAAGCAGGCA
GGTCTGTATGTGATTGCGCGCGCGGGACCTTACTGCAATGCTGAGACCTCTGCTGGTGGTTTCGCACTGTGGGCA
TCCAATGGGCAAATGGGCAGCACGCGCACGAGCGCAAGCACCTACTATGACCGATGGTATCCGTGGATCCAGAAG
ATCGGAAAGATCATCGCCGCAAACCAAATCACAAGCGGTGGTCCGGTCATTCTCAATCAGCACGAGAATGAGTTG
CAGGAGACAACACACAGTGCCAATAACACTGTTGTCAAGTACATGGAACAAGTTAAAGCCGCCTTCAATGAGGCT
GGTATCGTTGTCCCGAGCACGCATAATGAGAAGGGAATGCGCTCTATGAGCTGGTCGACGGACTACCAGGATGTG
GGTGGTGCCGTCAATGTCTATGGTTTGGACTCCTATCCTGGTGGTCTGTCCTGTACCAATCCAGATACTGGGTTC
AATCTCGTCCGCACTTATTACCAATGGTTCCAGAATTACTCGAGTTCTCAGCCCGAGTATCTGCCGGAGTTTGAG
GGCGGTTGGTTCTCCCCCTGGGGAGGGACGTTCTACGATCAATGTTCTACCGAGCTTTCGCCTGAATTCGCCGAT
GTCTACTATAAGAATAATATCGGCTCCAGAGTCACATTGCAGAATATATATATGGTGATGGGGGCAACTTCTTGG
GGCCACAGTGCTGCTCCGGTTGTCTATACTTCATATGACTACTCTGCGCCCATGCGAGAGACGCGTGAGATTCGG
GACAAACTCAAGCAGACCAAGTTGATCGGTCTGTTTACGCGCGTGTCATCTGGTCTTTTACAAATGCAAATGGAA
GGGAATGGAACAGGGTACACCAGTGATGCGGGTATATATACGTGGGCCTTGCGAAACCCAGAAACCCAAGCCGGT
TTCTATGTTCTCGCGCACTCTACCAGCTCATCTCGTGCTGTGACCACTACTTCACTTAATGTCAATACATCGGCT
GGGGCCCTGACAATCCCTAATATTGAGTTGGCCGGCCGTCAGAGCAAAATTATCGTCACTGACTACCGGATTGGC
CAGGGCTCGAGCTTGCTCTATTCATCCGCCGAGGTCTTGACCTACGCCACCCTCGACATAGATGTTATTGTCTTC
TATCTGAATATCGGACAAAAAGGAGAGTTTGTATTCAAAGACGCACCGACCCATCTGACTTTCCAAACTTACGGG
AATTCGAAAGTCAACTCTGGTGCATCGAATCATGGCACGAAATACACATACACTCAAGGGGATGGCACGACAGTG
CTGAAATTCTCGCACGGCGTACTGGTCTACCTTCTTGATAAGGAGACAGCGTGGAACTTCTTTGCAGTACCGACT
ACTTCCAATCCGATTGTGGTTCCCAGTGAGCAGATCATTGCCCTTGGGCCATATCTCGTTCGCACAGCGACTGTC
AGTGGGGATACTGTCAGTCTTGTTGGTGACAACGCAAACACAACATCTATTGAGGTCTACACGGGCAACTCAAAG
GTGACCAAAATCAAGTGGAATGGCAAAGAGATCTCAACCAAGAAGACACCATACGGCAGCTTAATCGGATCAGCC
CCGGGAGCCCAAGCCAAAGTATCGCTGCCGACTCTGAAATCATGGAAAGCGCAAGATACCCTTCCGGAGATTAAG
GCAGACTACGATGATTCTCGCTGGACCATCTGCAACAAAACGAGATCAGTCAACTCTGTGGCACCACTCACACTT
CCCGTGCTTTACTCTGGCGACTACGGCTACCATGCCGGAACGAAAATATATCGCGGACGGTTCGATGGCGTGACC
GCGACAGGCGCAAATCTCACTGTCCAGAACGGCGCAGCCGCTGGTTGGGCCGCCTGGCTAAACGGAGTCTACGTT
GGCGGAGCCATTGGTGATCCGACCCTAGCCGCGACATCAGCCGAGCTACTATTCAACAGCGCTACCTTGCGCAAG
ACAGACAATGTTCTGACCGTTATCATGGATTACACAGGCCACGACGAGGCGAACGTGTCGCCAAACGGAGCACAA
AACCCGCGTGGTATACTAGGCGCGACGCTTCTTGGTGGCGAATTCACTTCCTGGCGCATCCAAGGCAATGCAGGA
GGCGAAGCCAACATCGATCCCGTCCGGGGACCCATGAACGAAGGGGGTCTCTATGGAGAGCGTCTCGGTTGGCAT
CTCCCAGGATACAAAGCGCCCAAGACCGCAACCTCGCACAGTCCGCTGGACGGCATATCTGGTGCAGCAGGCCGG
TTCTACACGACGACGTTCCAGCTCGACCTGGACTCCGACCTGGACGTTCCGATTGGTCTGCAGCTCGATGCATCT
GCTGATTTCCCCGCAGTAGTCCAGATCTTCATGAATGGGTACCAGTTCGGTCATTACCTGCCACACATCGGTCCC
CAGACTAGGTTCCCTTTTCCACCTGGCGTGATCAATAACCGTGGGGAGAACACGTTGGCGATGAGTCTGTGGGCG
CTGACGGACCGAGGGGCGAGACTGAGTCAGGTGGATCTGGTTGCATATGGGGCTTATCGTACAGGATTCAACTTC
AATCACGATTGGTCATACCTGCAGCCACAATGGAAGAACAACCGGGAGCAATATGTGTAG
Gene >Pro_DTO070G2_2|g5544.t1
ATGTCGCGACTTATTGTGATCCTCGGTATTACGGGTGTGCAAGTAAGTTAGAATCGCTCCCTGTACAATTTCTTT
GGATATTCCCTGAGGTTACTAACACCAAAGCTGAAGGGAAGCTCCGTCGCCGACGCTTACCTTGTGAATCCGGGC
TGGAAGATTCGCGGTGTGACGCGCAATCCGGCATCTGATACTGCAAAGAAATGGGAGATGAAAGGTGTTGAAATG
ATCAAAGGTGACCTTGATGATGTGGCATCCTTGAGCGAGGCCTTTGTGGGAGCCGACATTATTTTTGGTGTCACC
GACTTCTGGACAATCTTCAAAGATCCAGAAAGTCACCAGAAGAAGAAGCCCGGCCAATCACTTGTGGAATATTGC
CACGATGTCGAGCTCCAACAGGGCAAGAATATTGCCGATGCTGCGGCCACTGTTCCTGGCCTATCCCGATACATC
TTCAGCTCAATGGCCCATGCGAAGAATTCCAGTAACAGCAAGTTCACCGAACTTTATCACATGGATTCTAAAGCA
GACGCTGCCATCTACGCACAGAGCATCCCGGCCCTGGCTGGAAAATTCTCGCAGGTTCAGGCGCCCATATATTTC
CAGCTCCCTTGGGAGTGGGGACTTCCTACAACCCCGAAGAAGGTATGAATCATGAAATCGCCCCGCCAGGACTTT
TGTTTTTTTTTCGTAATTCCCGGGCGTATTTTGAAGGTATTGACTCGTTGCATAGGTAGTTGATGGCACCTGGCG
AATGACAGGAATTGGCCCAGGTGACAAGGGCATTCCGTTCGGGCATGTCCGCAAGGATTTCGGCCCTTGCGTCAG
GGCAGTTGCAGAGTCCGAGCCCAATGTCAATTTATTTGCTGTTGGTGAATATGTATCGTGGTCAGATTACCTCCG
GATCTTTTGCGAAACCCAAGGTTTCAAGTATGGTGGCTATGACGAGCTTTCCTACGATAAATTCTGCGAGTTGCT
TCCCGGAGGTCTTGGTCACGAATTTGCTCACAATGTATTATTTGCACATGAGTTCGGGTACGAAGGTATCGATCC
TGCTGTTGTACGACCAGAGAAGGTATGTTATCCTATTCGATCTCGTTGCCACTCTGGGACATGACTGACCTTTCT
ATAGCTTGGTCTGAAAATGACCTCGTTCCGTGAATATTGCCAAGAGACTGATTTCTCGGCACTGGACGGTGACAA
GTGAGGCATTCAATGGGGAAGCTCTCGGTCAGCTGAGATCTGTCTCAGCTATGAGTAAACAGTAGTGTCAGGGGC
CATAGGAGTCAACTCAATCGATATCTCTTCTGGGGTCCAACTACAGCCGATAATATCATCTCATAAGCTCAAATA
TCCTCTATCCTAAAGTGTCGGTCTAAACCGCATGTGTAATATATAATATTACGCGCCGATGCTTTATGAAAAAGA
GTACATTCTAACTAGAACATCGAACATGGGGGGGAAAGGAAAGGAATCAGGGCCATTGTGAGTTTTGTACCCTTC
TCCTTGCCAGGCAAAATCTAGTATACTCTCCTACAGCTTAGGAAGGAACGATCCCTATAGAGAAGGAAGGAGCCA
ACGAGCCAACGACATAAGAAAAGAACTACCAAGCCTTGATCGTAACATAACCGCCCAAAAGTGCGTTCAGTCCCT
GAGGGTTGGATATTTCCCGCAACTATGTAGAGACGGTATTGTGGAATACGAGACTTGGCGAGTTGAATAGTGGCA
TAGCATCTTTTCGTTGAGGGAACAACGGTCAAGAGTGGGCTTGAGTTCTGGTGAATAACTGCATTTGGATGCTAG
CGTGGTGCATTTTATTGAGCAAGTCCGTGAGCTTATGTAATACTCAGCGACGTGCTCAGTTGTCCTCAGTGAGCA
AAAAGCGGCAAGGACTGAGCACTAAGACGGAAAGGGAAAGCCAAGAAGTGGCAGAGGAAATCAAGTACAGACGCA
TATTTGTATATCTGTATTCAATGTCCAAAATTCATTCAGAACCACCTGTCCCTAGTCAAAAGCCGATCATTCCCC
CGCATCTTCATGGAAAATTGCCTAATCCGACATTCGATCTCCAAAACAAAACATCCACCAATCCCAGCAGAGTAC
GGGGTATTTCTGTAGCGAGGACCGAAGCATACACACATTATAACAAGTCATATTCCAAGATGGAGAGTACCTGTG
CAGCCCCCAATAATGCGTCTTCTCACGATTCTCCCTATACTCCTTGGACTCATATCCAGCCATTTCGTCTCTGCG
ACAGATAATGGCAAGACTACTGATGTGACATGGGATCAATACAGCCTCTCAGTTAAAGGAGAGAGGGTATATGTG
TTCTCTGGTGAATTCCACTACCAGCGACTCCCCGTGCCGGAGCTTTGGCTCGACGTATTTCAGAAGCTACGCGCA
AATGGATTCAATGCGATTTCTAGTGAGTGGCTTGACAACACCCAGGCTGCACTGGTACTCATTGAGACTAGTCTA
CTTCTTCTGGAATTTCCACTCCGCTTCCGAAGATACTTTCGACTTCGAGAACGGTGCCCACGACGTCCAGCGCGT
CTTTGATTATGCCAAGCAGGCAGGTCTGTATGTGATTGCGCGCGCGGGACCTTACTGCAATGCTGAGACCTCTGC
TGGTGGTTTCGCACTGTGGGCATCCAATGGGCAAATGGGCAGCACGCGCACGAGCGCAAGCACCTACTATGACCG
ATGGTATCCGTGGATCCAGAAGATCGGAAAGATCATCGCCGCAAACCAAATCACAAGCGGTGGTCCGGTCATTCT
CAATCAGCACGAGAATGAGTTGCAGGAGACAACACACAGTGCCAATAACACTGTTGTCAAGTACATGGAACAAGT
TAAAGCCGCCTTCAATGAGGCTGGTATCGTTGTCCCGAGCACGCATAATGAGAAGGGAATGCGCTCTATGAGCTG
GTCGACGGACTACCAGGATGTGGGTGGTGCCGTCAATGTCTATGGTTTGGACTCCTATCCTGGTGGTCTGTCCTG
TACCAATCCAGATACTGGGTTCAATCTCGTCCGCACTTATTACCAATGGTTCCAGAATTACTCGAGTTCTCAGCC
CGAGTATCTGCCGGAGTTTGAGGGCGGTTGGTTCTCCCCCTGGGGAGGGACGTTCTACGATCAATGTTCTACCGA
GCTTTCGCCTGAATTCGCCGATGTCTACTATAAGAATAATATCGGCTCCAGAGTCACATTGCAGAATATATATAT
GGTGATGGGGGCAACTTCTTGGGGCCACAGTGCTGCTCCGGTTGTCTATACTTCATATGACTACTCTGCGCCCAT
GCGAGAGACGCGTGAGATTCGGGACAAACTCAAGCAGACCAAGTTGATCGGTCTGTTTACGCGCGTGTCATCTGG
TCTTTTACAAATGCAAATGGAAGGGAATGGAACAGGGTACACCAGTGATGCGGGTATATATACGTGGGCCTTGCG
AAACCCAGAAACCCAAGCCGGTTTCTATGTTCTCGCGCACTCTACCAGCTCATCTCGTGCTGTGACCACTACTTC
ACTTAATGTCAATACATCGGCTGGTACGTACTCCAGTGTTTGAGAGGAATAATTGCGCTAACTTGAATTCTACAC
GACAGGGGCCCTGACAATCCCTAATATTGAGTTGGCCGGCCGTCAGAGCAAAATTATCGTCACTGACTACCGGAT
TGGCCAGGGCTCGAGCTTGCTCTATTCATCCGCCGAGGTCTTGACCTACGCCACCCTCGACATAGATGTTATTGT
CTTCTATCTGAATATCGGACAAAAAGGAGAGTTTGTATTCAAAGACGCACCGACCCATCTGACTTTCCAAACTTA
CGGGAATTCGAAAGTCAACTCTGGTGCATCGAATCATGGCACGAAATACACATACACTCAAGGGGATGGCACGAC
AGTGCTGAAATTCTCGCACGGCGTACTGGTCTACCTTCTTGATAAGGAGACAGCGTGGAACTTCTTTGCAGTACC
GACTACTTCCAATCCGATTGTGGTTCCCAGTGAGCAGATCATTGCCCTTGGGCCATATCTCGTTCGCACAGCGAC
TGTCAGTGGGGATACTGTCAGTCTTGTTGGTGACAACGCAAACACAACATCTATTGAGTAAGCGCGAAGCTCTCA
AATAATTTACTCGCTAATATATGCTGTTAGGGTCTACACGGGCAACTCAAAGGTGACCAAAATCAAGTGGAATGG
CAAAGAGATCTCAACCAAGAAGACACCATACGGCAGCTTAATCGGATCAGCCCCGGGAGCCCAAGCCAAAGTATC
GCTGCCGACTCTGAAATCATGGAAAGCGCAAGATACCCTTCCGGAGATTAAGGCAGACTACGATGATTCTCGCTG
GACCATCTGCAACAAAACGAGATCAGTCAACTCTGTGGCACCACTCACACTTCCCGTGCTTTACTCTGGCGACTA
CGGCTACCATGCCGGAACGAAAATATATCGCGGACGGTTCGATGGCGTGACCGCGACAGGCGCAAATCTCACTGT
CCAGAACGGCGCAGCCGCTGGTTGGGCCGCCTGGCTAAACGGAGTCTACGTTGGCGGAGCCATTGGTGATCCGAC
CCTAGCCGCGACATCAGCCGAGCTACTATTCAACAGCGCTACCTTGCGCAAGACAGACAATGTTCTGACCGTTAT
CATGGATTACACAGGCCACGACGAGGCGAACGTGTCGCCAAACGGAGCACAAAACCCGCGTGGTATACTAGGCGC
GACGCTTCTTGGTGGCGAATTCACTTCCTGGCGCATCCAAGGCAATGCAGGAGGCGAAGCCAACATCGATCCCGT
CCGGGGACCCATGAACGAAGGGGGTCTCTATGGAGAGCGTCTCGGTTGGCATCTCCCAGGATACAAAGCGCCCAA
GACCGCAACCTCGCACAGTCCGCTGGACGGCATATCTGGTGCAGCAGGCCGGTTCTACACGACGACGTTCCAGCT
CGACCTGGACTCCGACCTGGACGTTCCGATTGGTCTGCAGCTCGATGCATCTGCTGATTTCCCCGCAGTAGTCCA
GATCTTCATGAATGGGTACCAGTTCGGTCATTACCTGCCACACATCGGTCCCCAGACTAGGTTCCCTTTTCCACC
TGGCGTGATCAATAACCGTGGGGAGAACACGTTGGCGATGAGTCTGTGGGCGCTGACGGACCGAGGGGCGAGACT
GAGTCAGGTGGATCTGGTTGCATATGGGGCTTATCGTACAGGATTCAACTTCAATCACGATTGGTCATACCTGCA
GCCACAATGGAAGAACAACCGGGAGCAATATGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail