Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g5522.t1
Gene name
Locationscaffold_07:318893..322198
Strand-
Gene length (bp)3305
Transcript length (bp)3123
Coding sequence length (bp)3123
Protein length (aa) 1041

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 4.9E-42 676 917
PF00501 AMP-binding AMP-binding enzyme 7.3E-29 14 336
PF01370 Epimerase NAD dependent epimerase/dehydratase family 7.1E-09 674 892
PF00550 PP-binding Phosphopantetheine attachment site 4.1E-06 556 626

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g5522.t1
MESFRKRLLATTIDEQAETKPTQRFAVISQGLDLSNGLRDISIKDLAQAVNFMCWWIESIIGPAHSDSPETVAYM
GGNDVRYLIFFLACQKTGYQAFLPSTRNSDEAYVHLLSAINCTKFFFGEERQERVLEIQGLVPKLDIFQAPTLNT
ILSDESGLRHYPYTKSYADAEDDIVCIIHSSGTTGMPKPVYLTNGFIMTFDSVTYLEKPPGRRPNTFHELDQSQL
LLAAAPFFHLMGLVTFIFSVWNECPMFVAPDKPLSVDYMIELLSTGHPTVALLPPSVLEDMSQSEKALASLKEVK
KVYFAGAPLPLEIGEKLRKYTEIITVIGSSEAGVIPGLIPEDKTNWGYFEWNEDYGVEMQDTGGGVFELVIPRKK
DSRDWKAVFHTYPELDAYPTNDLFTQHPTDPRLWKFCGRKDDVIVLSNGEKFNPIGMEGIIEGHPLVRKAVVVGQ
SRFQAGLLVDPSPAGWDMDPKVFIEEIWPVVQAANQTIAAHGRVMKNKIRLAVKTKPFQTTPKGNVRRRMVLQDY
EEEIDIIYTEDLVDDLDQSLPQTLDHESLTEYIRQVITRVLEKPEIADDQDFYAAGLDSLMTIHASRILQKGIQL
RRPDVEAGAINAQTIYGNPTVDRLSQSVMDILDGRAQADIPRAEKIKSLLEKYTSDLPVREVYRENGLPSPSTVI
LTGSTGSLGTYLLHDLLNSDSITKIYCLNRSDAEARQKKGFEEKGLHFDENDWKDKVEFLQVSFGEPQFGLDESK
YQELLDSVDTIIHNAWKVDFNHSVDSFEGTHIRGVRRFIDFSLNSRNNAHVHFVSSISTVGAWTPDKGDLVPEVP
IDDISVVLSQGYGESKHIAERICLEASQRSQVPTSVHRVGQIAGPTSARGQWNRQEWLPTIIATSKAMGKIPDQL
GSVAVDWVPVDTLSNIIVEIVNTRHRDSSEARSAVFHLTNPEQTSWSTLIPAVQSEYAVEPVAFSRWLGELESIT
NPSSEEVASKPALKLLGFYRGLEGEGSALSVPLDVQRTKAASASMRALGAVSPSLMRNWLQQWQF*
Coding >Pro_DTO070G2_2|g5522.t1
ATGGAATCTTTTCGGAAAAGACTGCTTGCGACAACGATCGATGAGCAGGCTGAAACCAAACCCACTCAACGATTT
GCAGTTATTTCACAGGGATTGGACCTCAGCAATGGGCTCCGAGACATTTCAATCAAAGACCTGGCACAGGCCGTG
AACTTCATGTGTTGGTGGATTGAGAGCATCATTGGACCGGCACACTCTGACTCCCCAGAGACGGTGGCCTATATG
GGGGGCAACGATGTGCGCTATCTCATCTTCTTTCTTGCATGCCAGAAGACTGGATATCAGGCCTTCTTGCCTTCT
ACCAGGAACTCAGACGAAGCGTATGTTCATCTACTGAGCGCGATAAACTGCACAAAGTTCTTCTTCGGCGAGGAG
CGTCAAGAACGAGTACTGGAGATACAGGGACTTGTTCCGAAATTGGACATCTTCCAGGCCCCGACCCTGAACACA
ATCCTCAGCGACGAGAGTGGTCTACGCCACTACCCATATACCAAGTCCTATGCCGATGCAGAGGATGACATTGTT
TGCATCATCCATAGCTCTGGAACGACAGGCATGCCCAAGCCGGTGTATCTCACCAACGGCTTCATCATGACCTTT
GATTCTGTCACTTACCTTGAAAAGCCACCAGGTCGCCGGCCAAATACATTCCACGAGCTGGATCAAAGTCAGCTG
CTGCTGGCCGCGGCACCTTTCTTCCATCTGATGGGACTAGTAACATTCATCTTCTCGGTGTGGAACGAATGTCCC
ATGTTCGTTGCCCCCGATAAGCCACTCTCTGTCGACTATATGATAGAGCTGCTGAGCACTGGCCACCCCACAGTC
GCACTCCTGCCACCCTCGGTCCTGGAAGATATGAGCCAATCCGAGAAAGCACTAGCTAGTTTGAAAGAAGTCAAA
AAAGTGTATTTCGCCGGCGCGCCTCTGCCCCTAGAGATCGGCGAGAAATTGCGCAAGTATACGGAGATCATAACG
GTAATTGGAAGCAGTGAGGCCGGCGTGATCCCAGGGCTAATACCGGAGGACAAAACCAACTGGGGCTACTTCGAA
TGGAATGAAGACTACGGAGTGGAAATGCAAGACACCGGCGGCGGCGTGTTCGAGTTGGTGATTCCTCGGAAGAAG
GATTCTCGCGACTGGAAGGCCGTTTTCCACACATATCCCGAGCTCGATGCGTATCCAACCAACGATCTCTTCACC
CAACACCCGACGGACCCACGTCTGTGGAAGTTCTGCGGGCGCAAGGACGATGTGATTGTCCTCAGCAATGGCGAA
AAGTTTAATCCTATCGGGATGGAGGGTATCATCGAGGGACACCCGCTGGTTCGGAAGGCGGTGGTAGTCGGCCAG
TCCCGGTTCCAGGCCGGACTGCTCGTCGATCCGAGTCCTGCGGGATGGGATATGGACCCGAAGGTCTTTATTGAG
GAGATCTGGCCGGTAGTACAGGCGGCTAACCAGACCATCGCGGCTCATGGCCGGGTAATGAAGAACAAGATCAGG
CTCGCTGTGAAGACAAAGCCATTCCAGACGACTCCTAAGGGTAACGTGCGGCGCCGGATGGTGCTTCAGGACTAC
GAGGAAGAGATTGATATAATATATACCGAGGACCTCGTGGATGACTTGGACCAGTCTCTACCGCAGACGTTAGAT
CATGAGAGTCTTACGGAGTATATCCGCCAGGTTATTACCCGTGTCCTGGAGAAACCCGAGATCGCAGATGATCAG
GACTTTTACGCTGCCGGTCTTGATTCTCTAATGACCATTCATGCCTCTCGGATACTGCAAAAGGGCATTCAGCTA
CGTCGGCCGGATGTAGAAGCAGGAGCCATCAACGCCCAGACGATCTATGGCAACCCCACAGTCGACCGATTGTCT
CAATCCGTGATGGACATCTTAGATGGAAGAGCCCAAGCTGATATCCCGCGAGCAGAGAAGATCAAGAGTCTGCTG
GAGAAGTATACGTCTGATCTTCCAGTGCGGGAAGTCTACCGCGAGAATGGATTGCCCTCGCCTTCGACTGTGATT
CTAACCGGTTCAACTGGCTCACTGGGTACTTATCTCCTGCATGATCTACTAAACAGCGATTCCATCACCAAGATC
TACTGCCTCAATCGTTCGGATGCCGAAGCACGACAGAAGAAAGGCTTCGAAGAAAAAGGCTTACACTTCGACGAA
AACGACTGGAAAGACAAGGTCGAGTTCCTACAAGTCTCATTCGGAGAACCACAATTCGGCCTGGACGAGTCCAAG
TACCAGGAACTTCTCGACTCGGTCGACACCATCATCCACAACGCCTGGAAAGTCGACTTCAACCACTCCGTCGAT
TCGTTCGAGGGCACTCACATCCGGGGTGTGCGGCGCTTTATCGACTTCAGCTTGAACAGCCGCAACAACGCCCAT
GTTCACTTCGTCTCCTCCATCAGCACGGTAGGCGCTTGGACCCCCGACAAGGGAGATCTGGTCCCAGAAGTACCG
ATCGACGACATTTCAGTCGTTCTCTCACAGGGCTACGGCGAGTCCAAGCACATTGCCGAGCGCATCTGTCTCGAG
GCATCGCAAAGATCTCAAGTCCCCACGTCGGTACATCGCGTCGGACAGATCGCGGGACCGACTAGCGCGCGCGGA
CAGTGGAATCGACAGGAATGGCTGCCGACGATCATTGCGACGTCAAAAGCGATGGGTAAAATCCCCGACCAACTC
GGCTCGGTCGCGGTCGATTGGGTTCCAGTGGACACACTATCCAATATTATAGTGGAAATTGTCAACACACGTCAT
CGGGACTCCTCCGAAGCAAGATCTGCCGTGTTTCATCTCACCAATCCCGAGCAGACATCATGGTCGACGTTGATC
CCGGCGGTCCAGAGCGAGTATGCAGTCGAGCCAGTTGCGTTCTCGAGGTGGCTTGGCGAGCTGGAGAGTATCACC
AATCCCAGCAGTGAGGAAGTTGCCTCCAAGCCGGCACTCAAGCTGCTGGGTTTCTACCGGGGGTTGGAAGGCGAG
GGCAGTGCCTTGTCTGTACCGCTGGATGTCCAGCGGACGAAAGCGGCAAGTGCCAGCATGAGAGCGCTGGGCGCG
GTCTCTCCCTCGTTGATGCGAAACTGGCTGCAGCAATGGCAATTCTGA
Transcript >Pro_DTO070G2_2|g5522.t1
ATGGAATCTTTTCGGAAAAGACTGCTTGCGACAACGATCGATGAGCAGGCTGAAACCAAACCCACTCAACGATTT
GCAGTTATTTCACAGGGATTGGACCTCAGCAATGGGCTCCGAGACATTTCAATCAAAGACCTGGCACAGGCCGTG
AACTTCATGTGTTGGTGGATTGAGAGCATCATTGGACCGGCACACTCTGACTCCCCAGAGACGGTGGCCTATATG
GGGGGCAACGATGTGCGCTATCTCATCTTCTTTCTTGCATGCCAGAAGACTGGATATCAGGCCTTCTTGCCTTCT
ACCAGGAACTCAGACGAAGCGTATGTTCATCTACTGAGCGCGATAAACTGCACAAAGTTCTTCTTCGGCGAGGAG
CGTCAAGAACGAGTACTGGAGATACAGGGACTTGTTCCGAAATTGGACATCTTCCAGGCCCCGACCCTGAACACA
ATCCTCAGCGACGAGAGTGGTCTACGCCACTACCCATATACCAAGTCCTATGCCGATGCAGAGGATGACATTGTT
TGCATCATCCATAGCTCTGGAACGACAGGCATGCCCAAGCCGGTGTATCTCACCAACGGCTTCATCATGACCTTT
GATTCTGTCACTTACCTTGAAAAGCCACCAGGTCGCCGGCCAAATACATTCCACGAGCTGGATCAAAGTCAGCTG
CTGCTGGCCGCGGCACCTTTCTTCCATCTGATGGGACTAGTAACATTCATCTTCTCGGTGTGGAACGAATGTCCC
ATGTTCGTTGCCCCCGATAAGCCACTCTCTGTCGACTATATGATAGAGCTGCTGAGCACTGGCCACCCCACAGTC
GCACTCCTGCCACCCTCGGTCCTGGAAGATATGAGCCAATCCGAGAAAGCACTAGCTAGTTTGAAAGAAGTCAAA
AAAGTGTATTTCGCCGGCGCGCCTCTGCCCCTAGAGATCGGCGAGAAATTGCGCAAGTATACGGAGATCATAACG
GTAATTGGAAGCAGTGAGGCCGGCGTGATCCCAGGGCTAATACCGGAGGACAAAACCAACTGGGGCTACTTCGAA
TGGAATGAAGACTACGGAGTGGAAATGCAAGACACCGGCGGCGGCGTGTTCGAGTTGGTGATTCCTCGGAAGAAG
GATTCTCGCGACTGGAAGGCCGTTTTCCACACATATCCCGAGCTCGATGCGTATCCAACCAACGATCTCTTCACC
CAACACCCGACGGACCCACGTCTGTGGAAGTTCTGCGGGCGCAAGGACGATGTGATTGTCCTCAGCAATGGCGAA
AAGTTTAATCCTATCGGGATGGAGGGTATCATCGAGGGACACCCGCTGGTTCGGAAGGCGGTGGTAGTCGGCCAG
TCCCGGTTCCAGGCCGGACTGCTCGTCGATCCGAGTCCTGCGGGATGGGATATGGACCCGAAGGTCTTTATTGAG
GAGATCTGGCCGGTAGTACAGGCGGCTAACCAGACCATCGCGGCTCATGGCCGGGTAATGAAGAACAAGATCAGG
CTCGCTGTGAAGACAAAGCCATTCCAGACGACTCCTAAGGGTAACGTGCGGCGCCGGATGGTGCTTCAGGACTAC
GAGGAAGAGATTGATATAATATATACCGAGGACCTCGTGGATGACTTGGACCAGTCTCTACCGCAGACGTTAGAT
CATGAGAGTCTTACGGAGTATATCCGCCAGGTTATTACCCGTGTCCTGGAGAAACCCGAGATCGCAGATGATCAG
GACTTTTACGCTGCCGGTCTTGATTCTCTAATGACCATTCATGCCTCTCGGATACTGCAAAAGGGCATTCAGCTA
CGTCGGCCGGATGTAGAAGCAGGAGCCATCAACGCCCAGACGATCTATGGCAACCCCACAGTCGACCGATTGTCT
CAATCCGTGATGGACATCTTAGATGGAAGAGCCCAAGCTGATATCCCGCGAGCAGAGAAGATCAAGAGTCTGCTG
GAGAAGTATACGTCTGATCTTCCAGTGCGGGAAGTCTACCGCGAGAATGGATTGCCCTCGCCTTCGACTGTGATT
CTAACCGGTTCAACTGGCTCACTGGGTACTTATCTCCTGCATGATCTACTAAACAGCGATTCCATCACCAAGATC
TACTGCCTCAATCGTTCGGATGCCGAAGCACGACAGAAGAAAGGCTTCGAAGAAAAAGGCTTACACTTCGACGAA
AACGACTGGAAAGACAAGGTCGAGTTCCTACAAGTCTCATTCGGAGAACCACAATTCGGCCTGGACGAGTCCAAG
TACCAGGAACTTCTCGACTCGGTCGACACCATCATCCACAACGCCTGGAAAGTCGACTTCAACCACTCCGTCGAT
TCGTTCGAGGGCACTCACATCCGGGGTGTGCGGCGCTTTATCGACTTCAGCTTGAACAGCCGCAACAACGCCCAT
GTTCACTTCGTCTCCTCCATCAGCACGGTAGGCGCTTGGACCCCCGACAAGGGAGATCTGGTCCCAGAAGTACCG
ATCGACGACATTTCAGTCGTTCTCTCACAGGGCTACGGCGAGTCCAAGCACATTGCCGAGCGCATCTGTCTCGAG
GCATCGCAAAGATCTCAAGTCCCCACGTCGGTACATCGCGTCGGACAGATCGCGGGACCGACTAGCGCGCGCGGA
CAGTGGAATCGACAGGAATGGCTGCCGACGATCATTGCGACGTCAAAAGCGATGGGTAAAATCCCCGACCAACTC
GGCTCGGTCGCGGTCGATTGGGTTCCAGTGGACACACTATCCAATATTATAGTGGAAATTGTCAACACACGTCAT
CGGGACTCCTCCGAAGCAAGATCTGCCGTGTTTCATCTCACCAATCCCGAGCAGACATCATGGTCGACGTTGATC
CCGGCGGTCCAGAGCGAGTATGCAGTCGAGCCAGTTGCGTTCTCGAGGTGGCTTGGCGAGCTGGAGAGTATCACC
AATCCCAGCAGTGAGGAAGTTGCCTCCAAGCCGGCACTCAAGCTGCTGGGTTTCTACCGGGGGTTGGAAGGCGAG
GGCAGTGCCTTGTCTGTACCGCTGGATGTCCAGCGGACGAAAGCGGCAAGTGCCAGCATGAGAGCGCTGGGCGCG
GTCTCTCCCTCGTTGATGCGAAACTGGCTGCAGCAATGGCAATTCTGA
Gene >Pro_DTO070G2_2|g5522.t1
ATGGAATCTTTTCGGAAAAGACTGCTTGCGACAACGATCGATGAGCAGGCTGAAACCAAACCCACTCAACGATTT
GCAGTTATTTCACAGGGATTGGACCTCAGCAATGGGCTCCGAGACATTTCAATCAAAGACCTGGCACAGGCCGTG
AACTTCATGTGTTGGTGGATTGAGAGCATCATTGGACCGGCACACTCTGACTCCCCAGAGACGGTGGCCTATATG
GGGGGCAACGATGTGCGCTATCTCATCTTCTTTCTTGCATGCCAGAAGACTGGATATCAGGTAAGGAAACATGCC
ACTCAAACTGAGAATAGAACAGCCGGACTGACTCTTATAGGCCTTCTTGCCTTCTACCAGGAACTCAGACGAAGC
GTATGTTCATCTACTGAGCGCGATAAACTGCACAAAGTTCTTCTTCGGCGAGGAGCGTCAAGAACGAGTACTGGA
GATACAGGGACTTGTTCCGAAATTGGACATCTTCCAGGCCCCGACCCTGAACACAATCCTCAGCGACGAGAGTGG
TCTACGCCACTACCCATATACCAAGTCCTATGCCGATGCAGAGGATGACATTGTTTGCATCATCCATAGCTCTGG
AACGACAGGTAAATCCCATGAACGTGGCACTGTGACTGTGAACCAAGCTAATTCCCGACAGGCATGCCCAAGCCG
GTGTATCTCACCAACGGCTTCATCATGACCTTTGATTCTGTCACTTACCTTGAAAAGCCACCAGGTCGCCGGCCA
AATACATTCCACGAGCTGGATCAAAGTCAGCTGCTGCTGGCCGCGGCACCTTTCTTCCATCTGATGGGACTAGTA
ACATTCATCTTCTCGGTGTGGAACGAATGTCCCATGTTCGTTGCCCCCGATAAGCCACTCTCTGTCGACTATATG
ATAGAGCTGCTGAGCACTGGCCACCCCACAGTCGCACTCCTGCCACCCTCGGTCCTGGAAGATATGAGCCAATCC
GAGAAAGCACTAGCTAGTTTGAAAGAAGTCAAAAAAGTGTATTTCGCCGGCGCGCCTCTGCCCCTAGAGATCGGC
GAGAAATTGCGCAAGTATACGGAGATCATAACGGTAATTGGAAGCAGTGAGGCCGGCGTGATCCCAGGGCTAATA
CCGGAGGACAAAACCAACTGGGGCTACTTCGAATGGAATGAAGACTACGGAGTGGAAATGCAAGACACCGGCGGC
GGCGTGTTCGAGTTGGTGATTCCTCGGAAGAAGGATTCTCGCGACTGGAAGGCCGTTTTCCACACATATCCCGAG
CTCGATGCGTATCCAACCAACGATCTCTTCACCCAACACCCGACGGACCCACGTCTGTGGAAGTTCTGCGGGCGC
AAGGACGATGTGATTGTCCTCAGCAATGGCGAAAAGTTTAATCCTATCGGGATGGAGGGTATCATCGAGGGACAC
CCGCTGGTTCGGAAGGCGGTGGTAGTCGGCCAGTCCCGGTTCCAGGCCGGACTGCTCGTCGATCCGAGTCCTGCG
GGATGGGATATGGACCCGAAGGTCTTTATTGAGGAGATCTGGCCGGTAGTACAGGCGGCTAACCAGACCATCGCG
GCTCATGGCCGGGTAATGAAGAACAAGATCAGGCTCGCTGTGAAGACAAAGCCATTCCAGACGACTCCTAAGGGT
AACGTGCGGCGCCGGATGGTGCTTCAGGACTACGAGGAAGAGATTGATATAATATATACCGAGGACCTCGTGGAT
GACTTGGACCAGTCTCTACCGCAGACGTTAGATCATGAGAGTCTTACGGAGTATATCCGCCAGGTTATTACCCGT
GTCCTGGAGAAACCCGAGATCGCAGATGATCAGGACTTTTACGCTGCCGGTCTTGATTCTCTAATGACCATTCAT
GCCTCTCGGATACTGCAAAAGGGCATTCAGCTACGTCGGCCGGATGTAGAAGCAGGAGCCATCAACGCCCAGACG
ATCTATGGCAACCCCACAGTCGACCGATTGTCTCAATCCGTGATGGACATCTTAGATGGAAGAGCCCAAGCTGAT
ATCCCGCGAGCAGAGAAGATCAAGAGTCTGCTGGAGAAGTATACGTCTGATCTTCCAGTGCGGGAAGTCTACCGC
GAGAATGGATTGCCCTCGCCTTCGACTGTGATTCTAACCGGTTCAACTGGCTCACTGGGTACTTATCTCCTGCAT
GATCTACTAAACAGCGATTCCATCACCAAGATCTACTGCCTCAATCGTTCGGATGCCGAAGCACGACAGAAGAAA
GGCTTCGAAGAAAAAGGCTTACACTTCGACGAAAACGACTGGAAAGACAAGGTCGAGTTCCTACAAGTCTCATTC
GGAGAACCACAATTCGGCCTGGACGAGTCCAAGTACCAGGAACTTCTCGACTCGGTCGACACCATCATCCACAAC
GCCTGGAAAGTCGACTTCAACCACTCCGTCGATTCGTTCGAGGGCACTCACATCCGGGGTGTGCGGCGCTTTATC
GACTTCAGCTTGAACAGCCGCAACAACGCCCATGTTCACTTCGTCTCCTCCATCAGCACGGTAGGCGCTTGGACC
CCCGACAAGGGAGATCTGGTCCCAGAAGTACCGATCGACGACATTTCAGTCGTTCTCTCACAGGGCTACGGCGAG
TCCAAGCACATTGCCGAGCGCATCTGTCTCGAGGCATCGCAAAGATCTCAAGTCCCCACGTCGGTACATCGCGTC
GGACAGATCGCGGGACCGACTAGCGCGCGCGGACAGTGGAATCGACAGGAATGGCTGCCGACGATCATTGCGACG
TCAAAAGCGATGGGTAAAATCCCCGACCAACTCGGCTCGGTCGCGGTCGATTGGGTTCCAGTGGTAAGTCCCCCG
AAAATTATGATTCACTAGCTCAGCCAAGAGAAAAAAATTTTAATTTTCTAACTGGATTTTAGGACACACTATCCA
ATATTATAGTGGAAATTGTCAACACACGTCATCGGGACTCCTCCGAAGCAAGATCTGCCGTGTTTCATCTCACCA
ATCCCGAGCAGACATCATGGTCGACGTTGATCCCGGCGGTCCAGAGCGAGTATGCAGTCGAGCCAGTTGCGTTCT
CGAGGTGGCTTGGCGAGCTGGAGAGTATCACCAATCCCAGCAGTGAGGAAGTTGCCTCCAAGCCGGCACTCAAGC
TGCTGGGTTTCTACCGGGGGTTGGAAGGCGAGGGCAGTGCCTTGTCTGTACCGCTGGATGTCCAGCGGACGAAAG
CGGCAAGTGCCAGCATGAGAGCGCTGGGCGCGGTCTCTCCCTCGTTGATGCGAAACTGGCTGCAGCAATGGCAAT
TCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail