Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g5410.t1
Gene name
Locationscaffold_07:16018..17540
Strand+
Gene length (bp)1522
Transcript length (bp)1320
Coding sequence length (bp)1320
Protein length (aa) 440

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00892 EamA EamA-like transporter family 2.2E-07 130 209
PF04142 Nuc_sug_transp Nucleotide-sugar transporter 2.6E-09 141 216
PF08449 UAA UAA transporter family 1.0E-06 129 409

GO

GO Term Description Terminal node
GO:0015165 pyrimidine nucleotide-sugar transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0000139 Golgi membrane Yes
GO:0016021 integral component of membrane Yes
GO:0016020 membrane Yes
GO:0090481 pyrimidine nucleotide-sugar transmembrane transport Yes
GO:0015931 nucleobase-containing compound transport No
GO:1901264 carbohydrate derivative transport No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:0015780 nucleotide-sugar transmembrane transport No
GO:1901505 carbohydrate derivative transmembrane transporter activity No
GO:0051179 localization No
GO:0006810 transport No
GO:0098588 bounding membrane of organelle No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0031090 organelle membrane No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0005338 nucleotide-sugar transmembrane transporter activity No
GO:0071702 organic substance transport No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 52 74 22
3 165 187 22
4 194 216 22
5 251 273 22
6 294 316 22
7 336 355 19
8 376 398 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g5410.t1
MANHALIPLLVTMMLVTGVCNTILNKYQDMQCVRNCDSPDPSQRKLFEQPVIQTAVMFMGEMGCWLVVGLTFLYR
QYIAPRLSSDPSPLLTGGYHPINGDDEGIDHEDDNIVDELDSDSRHPKPLPEDDSRIPLRGWKILLLAAPSSCDI
AGTTLMNVGLLFVAASIYQMTRGALVLFVGLFSVLFLRRKLHLYQWSALFIVVLGVAIVGLSGALFSGDSDHDIT
QDGSASNAVSHGLMQARVVARTPEAVQAIIGVLLIAAAQIFTATQFVLEEWILENYAMEPIHVVGWEGVFGFLVT
VVGMVIMYLAVGRTDAGRYGYFDVKQGLHEVLNNRAVAISSLFIMISIGGFNFFGLSVTRTVSATSRSTIDTCRT
LFIWIVSLGLGWETFKWLQVAGFALLVYGTFMFNDIVRPPLKACLPGDRREGEVLLPEGPIEHI*
Coding >Pro_DTO070G2_2|g5410.t1
ATGGCGAACCATGCCCTCATTCCCCTCCTGGTCACGATGATGCTCGTGACTGGGGTGTGCAACACCATTCTCAAC
AAGTATCAGGATATGCAATGTGTGCGAAACTGCGATTCCCCAGATCCCAGCCAGCGAAAGCTGTTCGAGCAGCCA
GTCATTCAGACAGCCGTAATGTTTATGGGTGAAATGGGCTGTTGGCTAGTTGTCGGCTTAACCTTCCTCTACCGC
CAATACATCGCACCGCGCCTATCCAGTGACCCCTCACCCCTCCTAACTGGCGGATATCACCCGATAAACGGCGAT
GATGAAGGCATCGATCATGAGGATGACAACATAGTCGATGAACTCGACAGCGATAGCAGACACCCCAAGCCCCTA
CCCGAAGATGACAGCCGCATCCCACTCCGCGGATGGAAGATCCTACTTCTTGCAGCGCCATCTAGCTGCGATATC
GCCGGCACAACCCTCATGAACGTGGGTCTTCTCTTTGTGGCAGCCAGTATCTACCAGATGACCCGGGGTGCCCTG
GTTCTATTTGTAGGCCTGTTCAGTGTCCTCTTCCTTCGCCGCAAGCTCCACTTATACCAGTGGAGTGCACTCTTC
ATTGTCGTTCTAGGTGTGGCTATTGTGGGTCTTTCCGGAGCTCTATTCAGTGGAGATTCAGACCACGATATCACT
CAGGATGGGAGTGCTAGCAATGCAGTCTCGCATGGTCTTATGCAGGCGCGTGTCGTTGCTCGGACCCCCGAGGCT
GTCCAGGCTATCATTGGTGTGCTGCTTATTGCCGCAGCGCAGATCTTCACAGCCACACAATTTGTGTTGGAGGAG
TGGATTTTGGAGAATTACGCCATGGAACCGATCCATGTTGTGGGTTGGGAAGGTGTGTTCGGATTTTTGGTTACT
GTCGTTGGCATGGTGATCATGTATCTTGCTGTCGGACGGACCGATGCCGGCCGATATGGCTACTTTGATGTCAAG
CAGGGATTGCACGAGGTTCTTAATAACCGTGCTGTTGCCATATCCAGCTTGTTTATCATGATCAGTATCGGTGGC
TTCAACTTCTTCGGTCTGTCTGTCACCCGCACTGTGTCTGCTACCTCTCGTAGCACAATCGACACCTGCCGCACA
CTCTTCATCTGGATTGTCTCGCTTGGACTCGGCTGGGAGACCTTCAAATGGCTCCAAGTTGCCGGATTCGCGCTT
CTTGTCTATGGAACTTTCATGTTCAATGACATCGTCCGTCCTCCGCTCAAGGCTTGTTTGCCCGGTGACCGGAGA
GAGGGAGAGGTGCTACTTCCCGAAGGCCCCATTGAGCATATCTGA
Transcript >Pro_DTO070G2_2|g5410.t1
ATGGCGAACCATGCCCTCATTCCCCTCCTGGTCACGATGATGCTCGTGACTGGGGTGTGCAACACCATTCTCAAC
AAGTATCAGGATATGCAATGTGTGCGAAACTGCGATTCCCCAGATCCCAGCCAGCGAAAGCTGTTCGAGCAGCCA
GTCATTCAGACAGCCGTAATGTTTATGGGTGAAATGGGCTGTTGGCTAGTTGTCGGCTTAACCTTCCTCTACCGC
CAATACATCGCACCGCGCCTATCCAGTGACCCCTCACCCCTCCTAACTGGCGGATATCACCCGATAAACGGCGAT
GATGAAGGCATCGATCATGAGGATGACAACATAGTCGATGAACTCGACAGCGATAGCAGACACCCCAAGCCCCTA
CCCGAAGATGACAGCCGCATCCCACTCCGCGGATGGAAGATCCTACTTCTTGCAGCGCCATCTAGCTGCGATATC
GCCGGCACAACCCTCATGAACGTGGGTCTTCTCTTTGTGGCAGCCAGTATCTACCAGATGACCCGGGGTGCCCTG
GTTCTATTTGTAGGCCTGTTCAGTGTCCTCTTCCTTCGCCGCAAGCTCCACTTATACCAGTGGAGTGCACTCTTC
ATTGTCGTTCTAGGTGTGGCTATTGTGGGTCTTTCCGGAGCTCTATTCAGTGGAGATTCAGACCACGATATCACT
CAGGATGGGAGTGCTAGCAATGCAGTCTCGCATGGTCTTATGCAGGCGCGTGTCGTTGCTCGGACCCCCGAGGCT
GTCCAGGCTATCATTGGTGTGCTGCTTATTGCCGCAGCGCAGATCTTCACAGCCACACAATTTGTGTTGGAGGAG
TGGATTTTGGAGAATTACGCCATGGAACCGATCCATGTTGTGGGTTGGGAAGGTGTGTTCGGATTTTTGGTTACT
GTCGTTGGCATGGTGATCATGTATCTTGCTGTCGGACGGACCGATGCCGGCCGATATGGCTACTTTGATGTCAAG
CAGGGATTGCACGAGGTTCTTAATAACCGTGCTGTTGCCATATCCAGCTTGTTTATCATGATCAGTATCGGTGGC
TTCAACTTCTTCGGTCTGTCTGTCACCCGCACTGTGTCTGCTACCTCTCGTAGCACAATCGACACCTGCCGCACA
CTCTTCATCTGGATTGTCTCGCTTGGACTCGGCTGGGAGACCTTCAAATGGCTCCAAGTTGCCGGATTCGCGCTT
CTTGTCTATGGAACTTTCATGTTCAATGACATCGTCCGTCCTCCGCTCAAGGCTTGTTTGCCCGGTGACCGGAGA
GAGGGAGAGGTGCTACTTCCCGAAGGCCCCATTGAGCATATCTGA
Gene >Pro_DTO070G2_2|g5410.t1
ATGGCGAACCATGCCCTCATTCCCCTCCTGGTCACGATGATGCTCGTGACTGGGGTGTGCAACACCATTCTCAAC
AAGTATCAGGTGCGTCCTTGATTCGATTCAAGCTACAAAGAAACACGAACTAATTGATTGGCCCGTCTCAAAAAG
GATATGCAATGTGTGCGAAACTGCGATTCCCCAGATCCCAGCCAGCGAAAGCTGTTCGAGCAGCCAGTCATTCAG
ACGTAGGCTCCACCCCGTGCCGATGATACAGCCTTACAACGCTAGCGATTAATGCTGACACCAGGCGGTAATGCA
GAGCCGTAATGTTTATGGGTGAAATGGGCTGTTGGCTAGTTGTCGGCTTAACCTTCCTCTACCGCCAATACATCG
CACCGCGCCTATCCAGTGACCCCTCACCCCTCCTAACTGGCGGATATCACCCGATAAACGGCGATGATGAAGGCA
TCGATCATGAGGATGACAACATAGTCGATGAACTCGACAGCGATAGCAGACACCCCAAGCCCCTACCCGAAGATG
ACAGCCGCATCCCACTCCGCGGATGGAAGATCCTACTTCTTGCAGCGCCATCTAGCTGCGATATCGCCGGCACAA
CCCTCATGAACGTGGGTCTTCTCTTTGTGGCAGCCAGTATCTACCAGATGACCCGGGGTGCCCTGGTTCTATTTG
TAGGCCTGTTCAGTGTCCTCTTCCTTCGCCGCAAGCTCCACTTATACCAGTGGAGTGCACTCTTCATTGTCGTTC
TAGGTGTGGCTATTGTGGGTCTTTCCGGAGCTCTATTCAGTGGAGATTCAGACCACGATATCACTCAGGATGGGA
GTGCTAGCAATGCAGTCTCGCATGGTCTTATGCAGGCGCGTGTCGTTGCTCGGACCCCCGAGGCTGTCCAGGCTA
TCATTGGTGTGCTGCTTATTGCCGCAGCGCAGATCTTCACAGCCACACAATTTGTGTTGGAGGAGTGGATTTTGG
AGAATTACGCCATGGAACCGATCCATGTTGTGGGTTGGGAAGGTGTGTTCGGATTTTTGGTTACTGTCGTTGGCA
TGGTGATCATGTATCTTGCTGTCGGACGGACCGATGCCGGCCGATATGGCTACTTTGATGTCAAGCAGGGATTGC
ACGAGGTTCTTAATAACCGTGCTGTTGCCATATCCAGCTTGTTTATCATGATCAGTATCGGGTATGTGTTGATCT
TGCTTCTCAACTCCATTTTTCCGCCCTCCCCTCTAACGTTCGTTCTAGTGGCTTCAACTTCTTCGGTCTGTCTGT
CACCCGCACTGTGTCTGCTACCTCTCGTAGCACAATCGACACCTGCCGCACACTCTTCATCTGGATTGTCTCGCT
TGGACTCGGCTGGGAGACCTTCAAATGGCTCCAAGTTGCCGGATTCGCGCTTCTTGTCTATGGAACTTTCATGTT
CAATGACATCGTCCGTCCTCCGCTCAAGGCTTGTTTGCCCGGTGACCGGAGAGAGGGAGAGGTGCTACTTCCCGA
AGGCCCCATTGAGCATATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail