Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g5302.t1
Gene name
Locationscaffold_06:950811..954316
Strand-
Gene length (bp)3505
Transcript length (bp)3375
Coding sequence length (bp)3375
Protein length (aa) 1125

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00368 HMG-CoA_red Hydroxymethylglutaryl-coenzyme A reductase 1.1E-136 715 1098
PF13323 HPIH N-terminal domain with HPIH motif 1.2E-49 27 179
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 1.8E-12 269 429

GO

GO Term Description Terminal node
GO:0015936 coenzyme A metabolic process Yes
GO:0004420 hydroxymethylglutaryl-CoA reductase (NADPH) activity Yes
GO:0072521 purine-containing compound metabolic process No
GO:0008150 biological_process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0019693 ribose phosphate metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0033865 nucleoside bisphosphate metabolic process No
GO:0034032 purine nucleoside bisphosphate metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0071704 organic substance metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0033875 ribonucleoside bisphosphate metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 241 263 22
2 270 292 22
3 296 318 22
4 370 389 19
5 399 421 22
6 482 501 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup2397
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g2819.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g2276.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g1595.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g4286.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g2326.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g1834.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g5133.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g5980.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g2899.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g2088.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g6539.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g7368.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g3979.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g5442.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g4731.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g3764.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g1741.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g1022.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g5302.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g4414.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g1929.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g2662.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g6897.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g2816.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g4654.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g4244.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g7587.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g2313.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g3964.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g2478.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g896.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g2754.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g2021.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g5138.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g5302.t1
MATSFITKRLRSNEEEQNTQPSWIRRQVVSGLQFISHRACVHPIHTLVVIAILASTTYVGLLEGSLLDTPKDSLS
VAGQVDTDALLQGSRNLRLGESTSWKWQAEDAWTDPQNKKPAAQHLALTTLIFPDSTNSDSTAPAADDVPIPADI
SANSVPYTPNLFSHFTHDASLVYTVPFEQVSELLRAVQEIPAPPTDGNEVESKKWIMRAARGPVHGSRRAVKLWI
ADSWNSFVDLIKHAETIDIVIMALGYLSMHLSFVSLFFSMRRLGSNFWLGATVLLSGTFAFLFGLHVTTRLGVPI
NLLLLSEGLPFLVVTIGFEKPIMFTRAVLKASVDNRRPLPGAAPRPLASSTPRSIQDSIAAAIKDQGYEIVQHYC
IEIGLLALGAASGVQGGLQQFCFLAALILFFDCVLLFTFYTTILCIKLEITRIKRHVALRKALEEDGITHTVAEN
VASSNDWPNARSGEADTSIFGRKIKSSNVRRFKIIMVGGLILINVVNMSAIPFRNTGNGGLLSRFSNVLSPTPID
PFKVAENGLDSVYVAAKSQKQETIVTILSPIKYKLEYPSVHYAALTDSGSFDIEYTDQFLDAVGGKVLESLLKSV
EDPVISKWIIAALTLSIILNGYLFNAARWSIKDPETLPEPVIAPKVYPKFEPNEQQSRRSVEECESLLRAKRAPL
LTDEELIDLSLRGKLPGYALEKSMEDENLMSRVDAFTRAVKIRRSVVSRTPTTSAITSVLENSKLPYLNYNYGLV
HGACCENVIGYLPLPVGVAGPLNIDGQNYFIPMATTEGVLVASTSRGSKAINAGGGAVTVLTGDGMTRGPCVTFP
TLARAAAAKVWIDSEEGRSIMTTAFNSTSRFARLQSIKTALAGTYLYIRFKTTTGDAMGMNMISKGCEKALDVMH
KECGFDDMSIISLSGNFCTDKKSAAINWTDGRGKSVVAEAIIPGHIVKSVLKSDVDALVELNVSKNLIGSAMAGS
LGGFNAHASNIVSAIFLATGQDPAQNVESSSCITTMKNNNGNLQIAVSMPSIEVGTIGGGTILEAQGAMLDLLGV
RGAHSTYPGENARQLSRIIAASVLAGELSLCSALAAGHLVKAHMAHNRSAAPTRSSTPVSSAVSATRGLSMTSK*
Coding >Pro_DTO070G2_2|g5302.t1
ATGGCTACCTCGTTCATCACCAAACGCCTTCGCTCAAACGAGGAAGAGCAGAATACTCAACCCAGCTGGATCCGG
CGTCAAGTTGTGTCAGGCCTCCAGTTTATTTCTCACCGGGCCTGTGTGCACCCTATTCACACTCTTGTGGTGATC
GCCATCCTTGCCAGCACTACCTATGTGGGTCTGCTCGAAGGCAGCCTGCTTGATACCCCGAAAGACTCGTTAAGT
GTCGCGGGACAGGTCGACACCGATGCCCTTCTCCAGGGAAGTCGAAATCTGCGACTCGGAGAATCAACTTCCTGG
AAGTGGCAGGCGGAAGATGCGTGGACTGACCCCCAGAATAAGAAGCCTGCTGCCCAGCACCTGGCTCTGACGACC
CTCATCTTCCCTGATTCCACCAACTCTGATTCAACTGCCCCGGCAGCTGATGATGTCCCGATTCCTGCCGATATC
TCCGCCAACTCGGTACCGTACACCCCGAACCTCTTCTCGCATTTTACTCATGACGCTTCCCTGGTTTACACCGTG
CCCTTTGAACAAGTCTCCGAACTTTTGAGAGCTGTGCAGGAGATCCCTGCCCCACCCACGGATGGGAATGAGGTG
GAATCCAAGAAATGGATCATGAGAGCTGCTCGTGGCCCGGTCCACGGATCCCGCAGAGCTGTAAAGCTCTGGATC
GCGGATTCATGGAATTCCTTTGTGGATCTGATCAAGCACGCGGAAACCATTGACATTGTTATCATGGCTCTTGGC
TACCTCTCGATGCACCTGAGTTTCGTCTCACTCTTCTTCTCCATGCGACGATTGGGCTCCAACTTTTGGCTTGGG
GCTACCGTGCTCCTCTCTGGCACCTTTGCATTCCTTTTTGGACTACACGTGACCACTAGGCTGGGCGTGCCTATC
AACCTCCTCTTGCTGTCTGAAGGTCTTCCATTCTTGGTTGTCACCATTGGATTTGAGAAGCCGATTATGTTCACT
CGGGCCGTCCTGAAAGCTTCCGTGGACAATCGCCGACCTCTTCCCGGCGCTGCCCCTCGCCCGCTGGCATCGAGC
ACACCGAGGTCCATCCAGGACTCTATCGCAGCTGCGATTAAGGACCAAGGTTACGAGATCGTTCAGCACTACTGC
ATTGAGATTGGTCTACTGGCTTTGGGTGCGGCATCTGGCGTCCAGGGTGGACTCCAGCAGTTCTGCTTCCTCGCA
GCTTTGATCTTGTTCTTTGACTGCGTGCTTCTCTTCACCTTCTATACCACCATTCTCTGCATCAAGCTCGAGATC
ACTCGGATAAAGCGTCACGTGGCACTTCGCAAGGCCTTAGAAGAAGATGGCATTACCCACACCGTTGCCGAGAAT
GTCGCTTCTAGCAACGACTGGCCTAACGCCAGATCTGGCGAGGCGGACACCAGCATCTTTGGCCGCAAGATCAAG
TCGAGCAATGTGCGCCGGTTCAAGATTATCATGGTTGGTGGTTTGATTTTGATCAATGTCGTGAACATGTCAGCC
ATTCCTTTCCGGAACACCGGCAACGGTGGCCTGCTCTCGCGTTTCTCCAACGTCCTGTCTCCTACCCCCATCGAT
CCTTTCAAAGTGGCAGAGAATGGCCTGGATAGTGTGTACGTGGCTGCCAAGAGCCAGAAGCAGGAGACTATTGTT
ACCATCCTTTCGCCGATCAAGTACAAGTTGGAGTACCCCTCAGTTCACTACGCAGCTCTTACCGACTCTGGTTCG
TTTGACATCGAGTACACTGATCAGTTCTTGGATGCCGTGGGTGGCAAGGTTCTCGAAAGTCTGCTCAAGAGCGTC
GAAGACCCTGTCATCAGCAAATGGATCATCGCCGCTTTGACTCTCAGCATCATCCTTAACGGATATCTTTTCAAT
GCTGCCCGTTGGAGTATCAAGGACCCTGAGACCCTTCCCGAGCCTGTGATCGCACCGAAGGTCTACCCCAAGTTT
GAACCAAATGAACAACAGTCAAGAAGGAGCGTCGAAGAATGCGAGTCTCTGCTCAGGGCAAAGCGTGCGCCCTTG
CTTACCGATGAGGAGCTGATCGATCTTTCCCTCCGCGGCAAGCTTCCAGGTTACGCGCTGGAAAAGTCTATGGAG
GATGAGAACTTGATGAGTCGTGTTGATGCCTTTACTCGTGCTGTGAAGATCCGCAGATCTGTGGTCTCCCGGACT
CCTACTACCTCTGCTATCACTTCCGTTTTGGAAAACTCCAAGCTCCCCTACCTGAATTACAACTATGGCCTTGTC
CACGGTGCTTGCTGTGAAAACGTTATCGGATACTTGCCCCTTCCTGTTGGTGTCGCTGGTCCTCTCAATATCGAT
GGACAAAATTACTTTATCCCCATGGCTACTACCGAAGGTGTCTTGGTGGCTAGTACAAGTCGTGGCTCCAAGGCA
ATCAACGCCGGTGGTGGTGCAGTGACTGTGCTGACCGGTGATGGTATGACTCGTGGTCCTTGTGTAACTTTCCCA
ACCTTGGCCCGGGCTGCCGCTGCTAAGGTTTGGATCGATTCCGAGGAAGGCCGGAGTATCATGACAACAGCTTTC
AACTCGACCAGTCGCTTTGCCCGTCTGCAGAGCATCAAGACTGCCCTTGCCGGAACCTACCTGTATATCCGCTTC
AAGACTACCACTGGTGATGCCATGGGTATGAACATGATCTCTAAAGGCTGCGAGAAGGCACTGGACGTTATGCAT
AAGGAGTGTGGTTTCGATGACATGTCCATCATTTCGCTTTCTGGTAACTTCTGCACAGATAAGAAGTCTGCTGCT
ATCAACTGGACTGATGGCCGTGGTAAGTCCGTCGTGGCAGAGGCTATCATTCCTGGCCATATTGTCAAGAGTGTC
CTTAAGAGCGACGTCGACGCACTGGTTGAGCTGAACGTCAGCAAGAATTTGATCGGAAGTGCGATGGCGGGCAGC
TTGGGTGGCTTCAACGCTCATGCTTCTAACATCGTGTCTGCCATTTTCCTGGCCACTGGTCAGGATCCGGCCCAG
AACGTTGAGAGCAGCAGCTGTATCACAACCATGAAGAACAACAATGGCAACCTCCAGATCGCTGTGTCTATGCCT
TCCATTGAGGTAGGCACCATTGGCGGTGGCACTATCCTTGAAGCGCAAGGTGCTATGCTGGATCTCCTGGGTGTC
CGCGGTGCTCACTCGACTTACCCCGGCGAAAACGCACGCCAGTTGTCTCGTATCATTGCTGCCTCCGTTCTCGCC
GGTGAGCTCAGTCTCTGCTCTGCGCTCGCCGCCGGTCATCTCGTCAAGGCACACATGGCCCACAACCGTAGCGCA
GCTCCCACACGGTCCTCAACCCCCGTGTCTTCTGCCGTTAGCGCCACCCGTGGCCTTTCCATGACCTCCAAATAA
Transcript >Pro_DTO070G2_2|g5302.t1
ATGGCTACCTCGTTCATCACCAAACGCCTTCGCTCAAACGAGGAAGAGCAGAATACTCAACCCAGCTGGATCCGG
CGTCAAGTTGTGTCAGGCCTCCAGTTTATTTCTCACCGGGCCTGTGTGCACCCTATTCACACTCTTGTGGTGATC
GCCATCCTTGCCAGCACTACCTATGTGGGTCTGCTCGAAGGCAGCCTGCTTGATACCCCGAAAGACTCGTTAAGT
GTCGCGGGACAGGTCGACACCGATGCCCTTCTCCAGGGAAGTCGAAATCTGCGACTCGGAGAATCAACTTCCTGG
AAGTGGCAGGCGGAAGATGCGTGGACTGACCCCCAGAATAAGAAGCCTGCTGCCCAGCACCTGGCTCTGACGACC
CTCATCTTCCCTGATTCCACCAACTCTGATTCAACTGCCCCGGCAGCTGATGATGTCCCGATTCCTGCCGATATC
TCCGCCAACTCGGTACCGTACACCCCGAACCTCTTCTCGCATTTTACTCATGACGCTTCCCTGGTTTACACCGTG
CCCTTTGAACAAGTCTCCGAACTTTTGAGAGCTGTGCAGGAGATCCCTGCCCCACCCACGGATGGGAATGAGGTG
GAATCCAAGAAATGGATCATGAGAGCTGCTCGTGGCCCGGTCCACGGATCCCGCAGAGCTGTAAAGCTCTGGATC
GCGGATTCATGGAATTCCTTTGTGGATCTGATCAAGCACGCGGAAACCATTGACATTGTTATCATGGCTCTTGGC
TACCTCTCGATGCACCTGAGTTTCGTCTCACTCTTCTTCTCCATGCGACGATTGGGCTCCAACTTTTGGCTTGGG
GCTACCGTGCTCCTCTCTGGCACCTTTGCATTCCTTTTTGGACTACACGTGACCACTAGGCTGGGCGTGCCTATC
AACCTCCTCTTGCTGTCTGAAGGTCTTCCATTCTTGGTTGTCACCATTGGATTTGAGAAGCCGATTATGTTCACT
CGGGCCGTCCTGAAAGCTTCCGTGGACAATCGCCGACCTCTTCCCGGCGCTGCCCCTCGCCCGCTGGCATCGAGC
ACACCGAGGTCCATCCAGGACTCTATCGCAGCTGCGATTAAGGACCAAGGTTACGAGATCGTTCAGCACTACTGC
ATTGAGATTGGTCTACTGGCTTTGGGTGCGGCATCTGGCGTCCAGGGTGGACTCCAGCAGTTCTGCTTCCTCGCA
GCTTTGATCTTGTTCTTTGACTGCGTGCTTCTCTTCACCTTCTATACCACCATTCTCTGCATCAAGCTCGAGATC
ACTCGGATAAAGCGTCACGTGGCACTTCGCAAGGCCTTAGAAGAAGATGGCATTACCCACACCGTTGCCGAGAAT
GTCGCTTCTAGCAACGACTGGCCTAACGCCAGATCTGGCGAGGCGGACACCAGCATCTTTGGCCGCAAGATCAAG
TCGAGCAATGTGCGCCGGTTCAAGATTATCATGGTTGGTGGTTTGATTTTGATCAATGTCGTGAACATGTCAGCC
ATTCCTTTCCGGAACACCGGCAACGGTGGCCTGCTCTCGCGTTTCTCCAACGTCCTGTCTCCTACCCCCATCGAT
CCTTTCAAAGTGGCAGAGAATGGCCTGGATAGTGTGTACGTGGCTGCCAAGAGCCAGAAGCAGGAGACTATTGTT
ACCATCCTTTCGCCGATCAAGTACAAGTTGGAGTACCCCTCAGTTCACTACGCAGCTCTTACCGACTCTGGTTCG
TTTGACATCGAGTACACTGATCAGTTCTTGGATGCCGTGGGTGGCAAGGTTCTCGAAAGTCTGCTCAAGAGCGTC
GAAGACCCTGTCATCAGCAAATGGATCATCGCCGCTTTGACTCTCAGCATCATCCTTAACGGATATCTTTTCAAT
GCTGCCCGTTGGAGTATCAAGGACCCTGAGACCCTTCCCGAGCCTGTGATCGCACCGAAGGTCTACCCCAAGTTT
GAACCAAATGAACAACAGTCAAGAAGGAGCGTCGAAGAATGCGAGTCTCTGCTCAGGGCAAAGCGTGCGCCCTTG
CTTACCGATGAGGAGCTGATCGATCTTTCCCTCCGCGGCAAGCTTCCAGGTTACGCGCTGGAAAAGTCTATGGAG
GATGAGAACTTGATGAGTCGTGTTGATGCCTTTACTCGTGCTGTGAAGATCCGCAGATCTGTGGTCTCCCGGACT
CCTACTACCTCTGCTATCACTTCCGTTTTGGAAAACTCCAAGCTCCCCTACCTGAATTACAACTATGGCCTTGTC
CACGGTGCTTGCTGTGAAAACGTTATCGGATACTTGCCCCTTCCTGTTGGTGTCGCTGGTCCTCTCAATATCGAT
GGACAAAATTACTTTATCCCCATGGCTACTACCGAAGGTGTCTTGGTGGCTAGTACAAGTCGTGGCTCCAAGGCA
ATCAACGCCGGTGGTGGTGCAGTGACTGTGCTGACCGGTGATGGTATGACTCGTGGTCCTTGTGTAACTTTCCCA
ACCTTGGCCCGGGCTGCCGCTGCTAAGGTTTGGATCGATTCCGAGGAAGGCCGGAGTATCATGACAACAGCTTTC
AACTCGACCAGTCGCTTTGCCCGTCTGCAGAGCATCAAGACTGCCCTTGCCGGAACCTACCTGTATATCCGCTTC
AAGACTACCACTGGTGATGCCATGGGTATGAACATGATCTCTAAAGGCTGCGAGAAGGCACTGGACGTTATGCAT
AAGGAGTGTGGTTTCGATGACATGTCCATCATTTCGCTTTCTGGTAACTTCTGCACAGATAAGAAGTCTGCTGCT
ATCAACTGGACTGATGGCCGTGGTAAGTCCGTCGTGGCAGAGGCTATCATTCCTGGCCATATTGTCAAGAGTGTC
CTTAAGAGCGACGTCGACGCACTGGTTGAGCTGAACGTCAGCAAGAATTTGATCGGAAGTGCGATGGCGGGCAGC
TTGGGTGGCTTCAACGCTCATGCTTCTAACATCGTGTCTGCCATTTTCCTGGCCACTGGTCAGGATCCGGCCCAG
AACGTTGAGAGCAGCAGCTGTATCACAACCATGAAGAACAACAATGGCAACCTCCAGATCGCTGTGTCTATGCCT
TCCATTGAGGTAGGCACCATTGGCGGTGGCACTATCCTTGAAGCGCAAGGTGCTATGCTGGATCTCCTGGGTGTC
CGCGGTGCTCACTCGACTTACCCCGGCGAAAACGCACGCCAGTTGTCTCGTATCATTGCTGCCTCCGTTCTCGCC
GGTGAGCTCAGTCTCTGCTCTGCGCTCGCCGCCGGTCATCTCGTCAAGGCACACATGGCCCACAACCGTAGCGCA
GCTCCCACACGGTCCTCAACCCCCGTGTCTTCTGCCGTTAGCGCCACCCGTGGCCTTTCCATGACCTCCAAATAA
Gene >Pro_DTO070G2_2|g5302.t1
ATGGCTACCTCGTTCATCACCAAACGCCTTCGCTCAAACGAGGAAGAGCAGAATACTCAACCCAGCTGGATCCGG
CGTCAAGTTGTGTCAGGCCTCCAGTTTATTTCTCACCGGGCCTGTGTGCACCCTATTCACACTCTTGTGGTGATC
GCCATCCTTGCCAGCACTACCTATGTGGGTCTGCTCGAAGGCAGCCTGCTTGATACCCCGAAAGACTCGTTAAGT
GTCGCGGGACAGGTCGACACCGATGCCCTTCTCCAGGGAAGTCGAAATCTGCGACTCGGAGAATCAACTTCCTGG
AAGTGGCAGGCGGAAGATGCGTGGACTGACCCCCAGGTGAGCCCATTTCACCCCACCGTTCTTCTTGGGCGTCGA
GAATGATATACTGACTCAATGAAATGTTAGAATAAGAAGCCTGCTGCCCAGCACCTGGCTCTGACGACCCTCATC
TTCCCTGATTCCACCAACTCTGATTCAACTGCCCCGGCAGCTGATGATGTCCCGATTCCTGCCGATATCTCCGCC
AACTCGGTACCGTACACCCCGAACCTCTTCTCGCATTTTACTCATGACGCTTCCCTGGTTTACACCGTGCCCTTT
GAACAAGTCTCCGAACTTTTGAGAGCTGTGCAGGAGATCCCTGCCCCACCCACGGATGGGAATGAGGTGGAATCC
AAGAAATGGATCATGAGAGCTGCTCGTGGCCCGGTCCACGGATCCCGCAGAGCTGTAAAGCTCTGGATCGCGGAT
TCATGGAATTCCTTTGTGGATCTGATCAAGCACGCGGAAACCATTGACATTGTTATCATGGCTCTTGGCTACCTC
TCGATGCACCTGAGTTTCGTCTCACTCTTCTTCTCCATGCGACGATTGGGCTCCAACTTTTGGCTTGGGGCTACC
GTGCTCCTCTCTGGCACCTTTGCATTCCTTTTTGGACTACACGTGACCACTAGGCTGGGCGTGCCTATCAACCTC
CTCTTGCTGTCTGAAGGTCTTCCATTCTTGGTTGTCACCATTGGATTTGAGAAGCCGATTATGTTCACTCGGGCC
GTCCTGAAAGCTTCCGTGGACAATCGCCGACCTCTTCCCGGCGCTGCCCCTCGCCCGCTGGCATCGAGCACACCG
AGGTCCATCCAGGACTCTATCGCAGCTGCGATTAAGGACCAAGGTTACGAGATCGTTCAGCACTACTGCATTGAG
ATTGGTCTACTGGCTTTGGGTGCGGCATCTGGCGTCCAGGGTGGACTCCAGCAGTTCTGCTTCCTCGCAGCTTTG
ATCTTGTTCTTTGACTGCGTGCTTCTCTTCACCTTCTATACCACCATTCTCTGCATCAAGCTCGAGATCACTCGG
ATAAAGCGTCACGTGGCACTTCGCAAGGCCTTAGAAGAAGATGGCATTACCCACACCGTTGCCGAGAATGTCGCT
TCTAGCAACGACTGGCCTAACGCCAGATCTGGCGAGGCGGACACCAGCATCTTTGGCCGCAAGATCAAGTCGAGC
AATGTGCGCCGGTTCAAGATTATCATGGTTGGTGGTTTGATTTTGATCAATGTCGTGAACATGTCAGCCATTCCT
TTCCGGAACACCGGCAACGGTGGCCTGCTCTCGCGTTTCTCCAACGTCCTGTCTCCTACCCCCATCGATCCTTTC
AAAGTGGCAGAGAATGGCCTGGATAGTGTGTACGTGGCTGCCAAGAGCCAGAAGCAGGAGACTATTGTTACCATC
CTTTCGCCGATCAAGTACAAGTTGGAGTACCCCTCAGTTCACTACGCAGCTCTTACCGACTCTGGTTCGTTTGAC
ATCGAGTACACTGATCAGTTCTTGGATGCCGTGGGTGGCAAGGTTCTCGAAAGTCTGCTCAAGAGCGTCGAAGAC
CCTGTCATCAGCAAATGGATCATCGCCGCTTTGACTCTCAGCATCATCCTTAACGGATATCTTTTCAATGCTGCC
CGTTGGAGTATCAAGGACCCTGAGACCCTTCCCGAGCCTGTGATCGCACCGAAGGTCTACCCCAAGTTTGAACCA
AATGAACAACAGTCAAGAAGGAGCGTCGAAGAATGCGAGTCTCTGCTCAGGGCAAAGCGTGCGCCCTTGCTTACC
GATGAGGAGCTGATCGATCTTTCCCTCCGCGGCAAGCTTCCAGGTTACGCGCTGGAAAAGTCTATGGAGGATGAG
AACTTGATGAGTCGTGTTGATGCCTTTACTCGTGCTGTGAAGATCCGCAGATCTGTGGTCTCCCGGACTCCTACT
ACCTCTGCTATCACTTCCGTTTTGGAAAACTCCAAGCTCCCCTACCTGAATTACAACTATGGCCTTGTCCACGGT
GCTTGCTGTGAAAACGTTATCGGATACTTGCCCCTTCCTGTTGGTGTCGCTGGTCCTCTCAATATCGATGGACAA
AATTACTTTATCCCCATGGCTACTACCGAAGGTGTCTTGGTGGCTAGTACAAGTCGTGGCTCCAAGGCAATCAAC
GCCGGTGGTGGTGCAGTGACTGTGCTGACCGGTGATGGTATGACTCGTGGTCCTTGTGTAACTTTCCCAACCTTG
GCCCGGGCTGCCGCTGCTAAGGTTTGGATCGATTCCGAGGAAGGCCGGAGTATCATGACAACAGCTTTCAACTCG
ACCAGTCGCTTTGCCCGTCTGCAGAGCATCAAGACTGCCCTTGCCGGAACCTACCTGTATATCCGCTTCAAGACT
ACCACTGGTGATGCCATGGGTATGAACATGATCTCTAAAGGCTGCGAGAAGGCACTGGACGTTATGCATAAGGAG
TGTGGTTTCGATGACATGTCCATCATTTCGCTTTCTGGTAACTTCTGCACAGATAAGAAGTCTGCTGCTATCAAC
TGGACTGATGGCCGTGGTAAGTCCGTCGTGGCAGAGGCTATCATTCCTGGCCATATTGTCAAGAGTGTCCTTAAG
AGCGACGTCGACGCACTGGTTGAGCTGAACGTCAGCAAGAATTTGATCGGAAGTGCGATGGCGGGCAGCTTGGGT
GGCTTCAACGCTCATGCTTCTAACATCGTGTCTGCCATTTTCCTGGCCACTGGTCAGGATCCGGCCCAGAACGTT
GAGAGCAGCAGCTGTATCACAACCATGAAGAAGTAAGCTTTATCATCCGCCACTTTTTGACCATTGAGATGCTAA
TAATGATTTCCTCAACAGCAACAATGGCAACCTCCAGATCGCTGTGTCTATGCCTTCCATTGAGGTAGGCACCAT
TGGCGGTGGCACTATCCTTGAAGCGCAAGGTGCTATGCTGGATCTCCTGGGTGTCCGCGGTGCTCACTCGACTTA
CCCCGGCGAAAACGCACGCCAGTTGTCTCGTATCATTGCTGCCTCCGTTCTCGCCGGTGAGCTCAGTCTCTGCTC
TGCGCTCGCCGCCGGTCATCTCGTCAAGGCACACATGGCCCACAACCGTAGCGCAGCTCCCACACGGTCCTCAAC
CCCCGTGTCTTCTGCCGTTAGCGCCACCCGTGGCCTTTCCATGACCTCCAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail