Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g4930.t1
Gene name
Locationscaffold_05:1369252..1375199
Strand+
Gene length (bp)5947
Transcript length (bp)5838
Coding sequence length (bp)5838
Protein length (aa) 1946

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02364 Glucan_synthase 1,3-beta-glucan synthase component 0.0E+00 869 1687
PF14288 FKS1_dom1 1,3-beta-glucan synthase subunit FKS1, domain-1 2.3E-44 356 463

GO

GO Term Description Terminal node
GO:0000148 1,3-beta-D-glucan synthase complex Yes
GO:0016020 membrane Yes
GO:0006075 (1->3)-beta-D-glucan biosynthetic process Yes
GO:0003843 1,3-beta-D-glucan synthase activity Yes
GO:0009250 glucan biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0000271 polysaccharide biosynthetic process No
GO:0008152 metabolic process No
GO:0044264 cellular polysaccharide metabolic process No
GO:0006073 cellular glucan metabolic process No
GO:0005575 cellular_component No
GO:0016740 transferase activity No
GO:0009987 cellular process No
GO:0046527 glucosyltransferase activity No
GO:0009058 biosynthetic process No
GO:0098796 membrane protein complex No
GO:0008194 UDP-glycosyltransferase activity No
GO:0051273 beta-glucan metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044238 primary metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0032991 protein-containing complex No
GO:0044042 glucan metabolic process No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0006074 (1->3)-beta-D-glucan metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0016757 glycosyltransferase activity No
GO:0051274 beta-glucan biosynthetic process No
GO:0003824 catalytic activity No
GO:0035251 UDP-glucosyltransferase activity No
GO:0005976 polysaccharide metabolic process No
GO:0044237 cellular metabolic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0003674 molecular_function No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1902494 catalytic complex No
GO:0005975 carbohydrate metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0033692 cellular polysaccharide biosynthetic process No
GO:1990234 transferase complex No
GO:0044249 cellular biosynthetic process No
GO:0098797 plasma membrane protein complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 510 532 22
2 545 567 22
3 587 609 22
4 621 643 22
5 678 700 22
6 736 758 22
7 1356 1378 22
8 1410 1432 22
9 1454 1476 22
10 1497 1519 22
11 1524 1546 22
12 1617 1639 22
13 1659 1681 22
14 1698 1720 22
15 1730 1752 22
16 1799 1818 19
17 1855 1877 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT48 0.0E+00 869 1647

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup3882
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g4394.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g1654.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g2079.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g1917.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g2525.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g8968.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g7574.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g3687.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g9500.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g6747.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g6853.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g7124.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g4880.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g7152.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g244.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g4063.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g6171.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g4231.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g4930.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g5059.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g6174.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g7311.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g3191.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g5223.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g2277.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g5513.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g9714.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g9207.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g2364.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g5251.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g7793.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g3910.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g5362.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g7534.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g4930.t1
MSGYAGGGQYDDGYAHGQAHGQAHGDAHGDSYYQDEHAQGYYDNQGYGDGYYDQGNGYYGADGVHADGAPGDHAA
HADAGHGYADGGYYEAGHIDPHAAEPYYDQGQGEPRGRRGHDSEEDSETFSDFTMRSETARAADMDYYGRGDERY
NSYSDSQYGGAGGYRPPSSQVSYGANRSSGASTPVYGMDYGNAIPAGQRSREPYPAWTSEAQIPLSKEELEDIFL
DLVNKFGFQRDSMRNMYDHMMTILDSRASRMTPNQALLSVHADYIGGQNANYRRWYFAAHLDLDDAVGFANMKLG
KADRKTRKARRAAAKAAKANPEDEEETLEALEGDNSLEAAEYRWKSRMNRMSQHDRARQVALYLLIWGEANQVRF
LPECICFIFKCADDYYTSPECQARVEPVEEFTYLNEIITPLYHYCRDQGYEIMDGKYVRRELDHNNIIGYDDMNQ
LFWYPEGIERIGFEDKTRLVDIPISERWPKLKDVVWKNAFFKTFKETRSWFHMITNFNRIWVIHLGAFWFFTAYN
APTLYTINYQQQVDNKPPTAKYLGAVGFGGALVSFIQILATICEWMYVPRRWAGAQHLHKRFMFLIVMFIINLAP
GIVIFAILPMLKMSTKTENGIGLAIGIVHFVIAVLTATFFAIQPLGALFGNYMKKGGRQYVASQTFTASFYRLSG
NDMWMSYGLWVCVFGAKLAESYFFLTLSFKDPIRILSPMQIHQCTGAQYIGNTLCHRQPQILLGLMAFMDLTLFF
LDSYLWYIICNTIFSVARSFYLGVSIWSPWRNIFSRLPKRIYSKVLATTDMEIKYKPKVLISQVWNAIIISMYRE
HLLAIDHVQKLLYHQVPSEQEGKRTLRAPTFFVSQEDQSFKTEFFPQGSEAERRISFFAQSLATPMPEPLPVDNM
PTFTVMIPHYSEKILLSLREIIREDEPYSRVTLLEYLKQLHPHEWDCFVKDTKILADETSQFNGDNEKPEKDAAK
SKVDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTISGFMNYSRAIKLLYRVENPEVVQMFGGNSEKLEREL
ERMARRKFRICVSMQRYAKFSKDERENTEFLLRAYPDLQIAYLDEEPPLNEGDEPRIYSALIDGHCEILENNLRK
PKFRIQLSGNPILGDGKSDNQNHCIIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEELTTDNVSPYTPGIASP
DENPVAILGAREYIFSESVGVLGDVAASKEQTFGTLFARTLAQIGGKLHYGHPDFLNATFMTTRGGVSKAQKGLH
LNEDIYAGMTAVLRGGRIKHCEYYQCGKGRDLGFGSVLNFTTKIGTGMGEQMLSREYYYLGTQLPLDRFLSFYYA
HPGFHLNNMFIMLSVQMFMFVLINLGALKHETIMCRYNSDLPITDPLVPTLCANLIPILNWVNRCVISIFIVFFI
SWVPLAVQELTERGVWRMATRLGKHFGSFSFMFEVFVCQIYANAVHANLSFGGARYIGTGRGFATARIPFGVLYS
RFAGPSIYLGARLLLMLLFSTTTVWTPALIWFWVSLLALSISPFLFNPHQFAWTDFFIDYRDYIRWLSRGNSRSH
ASSWIGFCRLSRTRITGYKRKVLGVPSEKGSGDIPRARITNIFFAEIVTPLLGVLATGIPYLYINSRTMYSDDPK
WAANPIIRLAIIAFAPVGINAGVAGMFFGMACCMGPLFGMCCKKFGAVLAAIAHAIAVIIFLIIFLAMFFLESLS
WPRTISGMIAAMALQRFLYKVIIALALTREFKNDQSNIAWWTGKWYGMGWHSLSQPGREFLCKITELGYFANDFF
LGHVLLFAMLPALAIPYVDTFHSVILFWLRPSSQIRPPIYSLKQSKLRKRRVVRFAILYFFTLFIFLIIIIAPIV
LRNTKQLDSILSGGIWDSLGVSKPSSIGLLQPLDHGLNDTVSWYTGSNIPKGYTSGSIPAASEGTGKWSI*
Coding >Pro_DTO070G2_2|g4930.t1
ATGTCGGGCTACGCAGGCGGAGGCCAGTACGACGATGGCTATGCCCACGGGCAGGCACATGGTCAAGCTCATGGG
GATGCTCATGGTGACTCGTACTACCAGGACGAACATGCACAGGGTTATTATGACAACCAAGGGTATGGCGATGGC
TACTACGATCAAGGTAATGGCTACTACGGAGCAGACGGTGTTCACGCCGACGGAGCTCCTGGGGATCATGCAGCT
CACGCGGATGCAGGCCACGGATACGCCGACGGCGGATACTACGAGGCTGGGCATATAGATCCCCACGCCGCAGAA
CCGTACTACGACCAGGGACAAGGGGAACCCCGAGGCCGTCGTGGTCATGATTCCGAGGAGGATTCCGAGACCTTC
AGCGATTTCACCATGAGGTCCGAGACTGCTCGGGCTGCGGACATGGACTACTATGGCCGTGGAGACGAGCGGTAC
AACAGCTACTCAGACAGCCAGTACGGCGGTGCTGGTGGATACCGTCCTCCTTCCTCTCAAGTTTCCTACGGTGCC
AACCGATCATCTGGCGCTTCAACTCCTGTCTACGGAATGGATTACGGCAACGCCATTCCCGCCGGCCAGCGCTCG
CGTGAGCCTTACCCGGCCTGGACTTCGGAGGCCCAGATCCCTCTCTCAAAGGAGGAGCTCGAGGATATCTTCTTG
GATCTGGTCAATAAGTTTGGATTCCAGCGAGACAGCATGCGCAACATGTATGACCACATGATGACTATTCTGGAC
TCTCGTGCCTCGCGTATGACCCCCAACCAGGCACTTCTCTCCGTTCACGCCGACTACATCGGCGGCCAGAACGCT
AATTATCGCCGATGGTACTTTGCCGCCCATCTCGATCTCGATGATGCGGTCGGTTTCGCCAACATGAAGCTCGGC
AAGGCAGACCGCAAGACGCGGAAGGCTCGCAGGGCTGCAGCCAAGGCCGCCAAAGCTAACCCCGAGGACGAAGAG
GAAACGCTCGAGGCTTTGGAAGGAGACAACAGCTTGGAAGCTGCGGAATACCGCTGGAAGTCTCGCATGAACCGG
ATGTCCCAGCACGACCGGGCCCGCCAAGTTGCCCTCTATCTTCTGATCTGGGGTGAAGCCAACCAGGTGCGATTC
CTGCCGGAGTGTATCTGTTTCATCTTCAAGTGTGCCGACGATTACTACACTTCGCCCGAATGCCAGGCGCGCGTT
GAACCGGTGGAGGAATTCACCTACCTCAATGAGATCATCACTCCTCTCTACCATTACTGTCGAGACCAGGGATAT
GAAATCATGGACGGCAAGTATGTTCGTCGTGAGCTCGATCACAACAACATCATTGGTTACGATGACATGAACCAA
CTGTTCTGGTACCCGGAGGGTATCGAGCGCATCGGGTTTGAGGATAAGACCCGCCTGGTCGATATTCCTATCTCT
GAAAGATGGCCCAAGTTGAAGGATGTGGTCTGGAAGAATGCCTTCTTCAAGACTTTCAAGGAAACTCGCTCCTGG
TTCCACATGATCACGAACTTCAACCGTATCTGGGTTATCCACCTGGGTGCCTTCTGGTTCTTCACTGCCTACAAC
GCTCCAACTCTGTATACCATCAACTACCAACAACAGGTGGACAACAAGCCACCGACGGCTAAATACCTCGGCGCT
GTCGGTTTCGGTGGTGCTCTTGTCTCCTTCATTCAGATTCTAGCTACCATTTGTGAATGGATGTACGTTCCCCGA
CGGTGGGCTGGAGCGCAGCACCTGCACAAACGGTTCATGTTCCTCATTGTCATGTTCATTATCAACCTGGCTCCT
GGAATCGTCATCTTCGCCATCTTGCCCATGCTGAAAATGTCAACCAAGACAGAAAACGGCATCGGCCTCGCCATC
GGTATTGTCCACTTTGTTATCGCAGTCCTGACAGCCACTTTCTTCGCAATCCAGCCCTTGGGTGCGCTTTTCGGC
AATTACATGAAGAAAGGTGGACGCCAATACGTTGCCAGTCAGACCTTCACGGCTAGTTTCTATCGTCTTTCAGGT
AACGACATGTGGATGTCATACGGCCTCTGGGTCTGTGTGTTCGGTGCCAAGTTGGCGGAATCCTACTTCTTCTTG
ACGCTATCTTTCAAGGATCCCATCCGCATCTTGTCCCCAATGCAGATCCACCAGTGTACTGGCGCGCAATACATT
GGCAACACCCTTTGCCACCGACAGCCTCAGATTCTTCTGGGCTTGATGGCTTTCATGGACTTGACACTTTTCTTC
CTGGATAGTTACTTGTGGTACATTATTTGCAACACAATCTTCTCTGTGGCGCGATCATTCTATTTGGGTGTGTCA
ATTTGGTCACCGTGGAGAAACATCTTCTCCCGCCTGCCGAAGCGTATCTACTCCAAGGTGCTTGCCACTACCGAC
ATGGAGATCAAATACAAGCCCAAGGTCTTGATCTCGCAAGTTTGGAATGCGATTATCATCTCCATGTACCGTGAG
CATCTTCTCGCCATCGACCATGTGCAGAAGCTGCTTTACCACCAGGTTCCCTCCGAGCAGGAAGGAAAGCGCACC
CTCCGCGCCCCAACCTTCTTCGTGTCACAGGAAGATCAATCTTTCAAGACTGAGTTCTTCCCACAGGGTAGTGAG
GCCGAGCGTCGTATTTCGTTCTTCGCCCAATCGCTCGCTACACCCATGCCCGAGCCTCTTCCCGTTGACAACATG
CCCACTTTCACGGTCATGATTCCCCACTACAGTGAAAAGATCCTTTTGTCGCTCCGCGAGATTATCCGTGAAGAT
GAGCCTTACTCGCGTGTCACTTTGCTGGAATACCTCAAGCAATTGCACCCTCACGAGTGGGATTGCTTCGTCAAG
GATACCAAGATCCTCGCCGATGAGACTTCGCAGTTCAACGGTGATAATGAGAAGCCCGAGAAAGACGCTGCCAAG
AGCAAGGTTGATGACCTGCCTTTCTACTGCATTGGTTTCAAGTCCGCCGCTCCCGAATATACCCTCCGCACCAGA
ATCTGGGCTTCCCTCCGATCCCAGACCTTGTACAGGACTATTTCTGGCTTCATGAATTACAGCCGTGCTATCAAG
CTGCTTTACCGTGTCGAAAACCCGGAGGTTGTCCAAATGTTTGGTGGTAACTCGGAGAAACTCGAGCGCGAGCTC
GAGCGCATGGCTCGCCGCAAGTTCCGTATCTGTGTCTCCATGCAGCGTTACGCCAAGTTCAGCAAGGACGAACGT
GAAAACACCGAATTCTTGCTCCGCGCTTACCCCGACCTGCAGATTGCATACTTGGATGAGGAGCCACCTCTCAAT
GAAGGCGACGAGCCCCGTATCTACTCGGCTTTGATCGATGGTCACTGTGAAATTCTCGAGAACAACTTGCGGAAG
CCCAAGTTCAGAATTCAGCTTTCTGGAAACCCCATTCTCGGTGACGGAAAGTCCGACAACCAGAACCATTGCATC
ATCTTCTACCGTGGTGAATACATCCAGCTTATTGACGCCAATCAAGACAACTACTTGGAAGAATGTTTGAAGATT
CGCAGTGTCCTGGCCGAGTTCGAGGAACTGACCACTGATAATGTTTCTCCATACACCCCTGGAATTGCCTCGCCT
GACGAGAACCCCGTTGCCATTTTGGGAGCCCGTGAATACATTTTCTCCGAGAGCGTCGGTGTTCTCGGTGATGTT
GCCGCCTCCAAGGAACAAACGTTCGGTACTCTTTTCGCTCGTACACTGGCTCAAATCGGTGGTAAGCTTCACTAT
GGTCATCCTGATTTCTTGAATGCCACTTTCATGACGACTCGTGGTGGTGTCTCCAAAGCCCAGAAAGGATTGCAC
TTGAACGAGGATATTTACGCTGGTATGACTGCTGTTCTCCGAGGAGGTCGCATCAAGCATTGTGAATATTATCAG
TGTGGTAAGGGTCGTGATCTTGGTTTCGGATCCGTTCTCAACTTCACCACGAAGATTGGTACTGGTATGGGTGAA
CAGATGCTTTCCCGAGAGTACTACTATCTCGGTACCCAGCTGCCCCTCGATCGCTTCCTCTCATTCTACTATGCT
CACCCTGGTTTCCATCTGAACAACATGTTCATTATGTTGTCTGTGCAAATGTTCATGTTTGTCCTGATCAACCTT
GGCGCCCTGAAGCACGAGACCATCATGTGCCGTTACAACTCCGACCTGCCTATTACCGATCCTCTTGTGCCTACT
CTCTGCGCCAACCTGATTCCAATCCTCAACTGGGTGAACCGCTGTGTTATCTCCATTTTCATTGTGTTCTTCATC
TCATGGGTTCCTCTTGCAGTCCAAGAGCTGACGGAGAGAGGAGTGTGGCGCATGGCTACTCGTCTGGGCAAGCAT
TTCGGTTCGTTCTCGTTCATGTTCGAGGTGTTCGTTTGTCAGATCTACGCCAACGCCGTGCACGCCAACTTGTCT
TTCGGTGGTGCGCGATACATTGGTACCGGTCGTGGTTTCGCAACGGCTCGTATCCCATTCGGTGTCCTCTACTCA
CGATTCGCTGGGCCTTCAATTTACCTGGGCGCTCGCCTCCTGCTGATGCTGTTGTTCAGTACCACAACGGTCTGG
ACTCCCGCTCTGATCTGGTTCTGGGTTTCCCTACTCGCGCTGAGCATTTCGCCTTTCCTGTTCAACCCCCACCAG
TTTGCCTGGACCGACTTCTTCATCGACTACCGCGACTACATCCGCTGGCTTTCTCGCGGTAACTCCCGATCCCAT
GCTTCCTCTTGGATCGGTTTCTGTCGCCTTTCGCGTACTCGTATCACTGGTTACAAGCGGAAAGTGCTTGGTGTT
CCATCGGAGAAAGGCTCCGGTGATATTCCTAGGGCGCGAATCACCAACATTTTCTTCGCCGAAATTGTTACGCCT
CTGCTTGGTGTTCTGGCAACAGGAATCCCGTACCTATACATCAACTCGCGGACAATGTATTCTGATGATCCCAAG
TGGGCTGCGAATCCCATCATTCGCCTTGCGATTATTGCTTTTGCCCCCGTCGGTATCAATGCCGGCGTCGCGGGT
ATGTTCTTCGGCATGGCTTGCTGTATGGGCCCATTGTTTGGCATGTGCTGCAAGAAGTTCGGTGCTGTCCTTGCT
GCTATTGCCCATGCCATCGCTGTGATTATCTTCCTCATCATCTTCCTGGCCATGTTCTTCCTGGAATCCCTCAGC
TGGCCCCGAACCATCTCTGGCATGATCGCTGCTATGGCTCTCCAGCGCTTCCTCTACAAGGTGATCATTGCCCTC
GCTCTGACCCGTGAATTCAAGAACGATCAATCCAATATTGCATGGTGGACCGGAAAATGGTACGGCATGGGTTGG
CACTCCCTTTCTCAGCCTGGACGTGAGTTCCTGTGCAAAATCACTGAACTTGGTTATTTCGCCAACGATTTCTTC
CTTGGCCATGTTCTCCTGTTTGCCATGCTCCCGGCCCTCGCCATTCCCTATGTCGACACCTTCCATTCGGTCATC
CTGTTTTGGCTGCGCCCAAGCTCTCAAATTCGCCCTCCTATCTACTCTCTCAAGCAGTCCAAGCTTCGCAAGAGA
CGCGTTGTTCGCTTCGCCATTCTCTACTTCTTCACGCTCTTCATCTTCCTCATTATTATCATTGCGCCTATTGTG
CTGCGAAATACGAAGCAATTGGATAGCATCTTGTCCGGCGGCATCTGGGACAGCCTGGGTGTCTCTAAGCCGTCT
TCGATTGGTCTTCTGCAACCACTTGATCACGGACTCAATGACACCGTCTCCTGGTACACTGGCTCTAATATCCCC
AAGGGCTACACCTCAGGCAGCATCCCAGCCGCCTCCGAGGGCACCGGAAAGTGGTCCATCTAA
Transcript >Pro_DTO070G2_2|g4930.t1
ATGTCGGGCTACGCAGGCGGAGGCCAGTACGACGATGGCTATGCCCACGGGCAGGCACATGGTCAAGCTCATGGG
GATGCTCATGGTGACTCGTACTACCAGGACGAACATGCACAGGGTTATTATGACAACCAAGGGTATGGCGATGGC
TACTACGATCAAGGTAATGGCTACTACGGAGCAGACGGTGTTCACGCCGACGGAGCTCCTGGGGATCATGCAGCT
CACGCGGATGCAGGCCACGGATACGCCGACGGCGGATACTACGAGGCTGGGCATATAGATCCCCACGCCGCAGAA
CCGTACTACGACCAGGGACAAGGGGAACCCCGAGGCCGTCGTGGTCATGATTCCGAGGAGGATTCCGAGACCTTC
AGCGATTTCACCATGAGGTCCGAGACTGCTCGGGCTGCGGACATGGACTACTATGGCCGTGGAGACGAGCGGTAC
AACAGCTACTCAGACAGCCAGTACGGCGGTGCTGGTGGATACCGTCCTCCTTCCTCTCAAGTTTCCTACGGTGCC
AACCGATCATCTGGCGCTTCAACTCCTGTCTACGGAATGGATTACGGCAACGCCATTCCCGCCGGCCAGCGCTCG
CGTGAGCCTTACCCGGCCTGGACTTCGGAGGCCCAGATCCCTCTCTCAAAGGAGGAGCTCGAGGATATCTTCTTG
GATCTGGTCAATAAGTTTGGATTCCAGCGAGACAGCATGCGCAACATGTATGACCACATGATGACTATTCTGGAC
TCTCGTGCCTCGCGTATGACCCCCAACCAGGCACTTCTCTCCGTTCACGCCGACTACATCGGCGGCCAGAACGCT
AATTATCGCCGATGGTACTTTGCCGCCCATCTCGATCTCGATGATGCGGTCGGTTTCGCCAACATGAAGCTCGGC
AAGGCAGACCGCAAGACGCGGAAGGCTCGCAGGGCTGCAGCCAAGGCCGCCAAAGCTAACCCCGAGGACGAAGAG
GAAACGCTCGAGGCTTTGGAAGGAGACAACAGCTTGGAAGCTGCGGAATACCGCTGGAAGTCTCGCATGAACCGG
ATGTCCCAGCACGACCGGGCCCGCCAAGTTGCCCTCTATCTTCTGATCTGGGGTGAAGCCAACCAGGTGCGATTC
CTGCCGGAGTGTATCTGTTTCATCTTCAAGTGTGCCGACGATTACTACACTTCGCCCGAATGCCAGGCGCGCGTT
GAACCGGTGGAGGAATTCACCTACCTCAATGAGATCATCACTCCTCTCTACCATTACTGTCGAGACCAGGGATAT
GAAATCATGGACGGCAAGTATGTTCGTCGTGAGCTCGATCACAACAACATCATTGGTTACGATGACATGAACCAA
CTGTTCTGGTACCCGGAGGGTATCGAGCGCATCGGGTTTGAGGATAAGACCCGCCTGGTCGATATTCCTATCTCT
GAAAGATGGCCCAAGTTGAAGGATGTGGTCTGGAAGAATGCCTTCTTCAAGACTTTCAAGGAAACTCGCTCCTGG
TTCCACATGATCACGAACTTCAACCGTATCTGGGTTATCCACCTGGGTGCCTTCTGGTTCTTCACTGCCTACAAC
GCTCCAACTCTGTATACCATCAACTACCAACAACAGGTGGACAACAAGCCACCGACGGCTAAATACCTCGGCGCT
GTCGGTTTCGGTGGTGCTCTTGTCTCCTTCATTCAGATTCTAGCTACCATTTGTGAATGGATGTACGTTCCCCGA
CGGTGGGCTGGAGCGCAGCACCTGCACAAACGGTTCATGTTCCTCATTGTCATGTTCATTATCAACCTGGCTCCT
GGAATCGTCATCTTCGCCATCTTGCCCATGCTGAAAATGTCAACCAAGACAGAAAACGGCATCGGCCTCGCCATC
GGTATTGTCCACTTTGTTATCGCAGTCCTGACAGCCACTTTCTTCGCAATCCAGCCCTTGGGTGCGCTTTTCGGC
AATTACATGAAGAAAGGTGGACGCCAATACGTTGCCAGTCAGACCTTCACGGCTAGTTTCTATCGTCTTTCAGGT
AACGACATGTGGATGTCATACGGCCTCTGGGTCTGTGTGTTCGGTGCCAAGTTGGCGGAATCCTACTTCTTCTTG
ACGCTATCTTTCAAGGATCCCATCCGCATCTTGTCCCCAATGCAGATCCACCAGTGTACTGGCGCGCAATACATT
GGCAACACCCTTTGCCACCGACAGCCTCAGATTCTTCTGGGCTTGATGGCTTTCATGGACTTGACACTTTTCTTC
CTGGATAGTTACTTGTGGTACATTATTTGCAACACAATCTTCTCTGTGGCGCGATCATTCTATTTGGGTGTGTCA
ATTTGGTCACCGTGGAGAAACATCTTCTCCCGCCTGCCGAAGCGTATCTACTCCAAGGTGCTTGCCACTACCGAC
ATGGAGATCAAATACAAGCCCAAGGTCTTGATCTCGCAAGTTTGGAATGCGATTATCATCTCCATGTACCGTGAG
CATCTTCTCGCCATCGACCATGTGCAGAAGCTGCTTTACCACCAGGTTCCCTCCGAGCAGGAAGGAAAGCGCACC
CTCCGCGCCCCAACCTTCTTCGTGTCACAGGAAGATCAATCTTTCAAGACTGAGTTCTTCCCACAGGGTAGTGAG
GCCGAGCGTCGTATTTCGTTCTTCGCCCAATCGCTCGCTACACCCATGCCCGAGCCTCTTCCCGTTGACAACATG
CCCACTTTCACGGTCATGATTCCCCACTACAGTGAAAAGATCCTTTTGTCGCTCCGCGAGATTATCCGTGAAGAT
GAGCCTTACTCGCGTGTCACTTTGCTGGAATACCTCAAGCAATTGCACCCTCACGAGTGGGATTGCTTCGTCAAG
GATACCAAGATCCTCGCCGATGAGACTTCGCAGTTCAACGGTGATAATGAGAAGCCCGAGAAAGACGCTGCCAAG
AGCAAGGTTGATGACCTGCCTTTCTACTGCATTGGTTTCAAGTCCGCCGCTCCCGAATATACCCTCCGCACCAGA
ATCTGGGCTTCCCTCCGATCCCAGACCTTGTACAGGACTATTTCTGGCTTCATGAATTACAGCCGTGCTATCAAG
CTGCTTTACCGTGTCGAAAACCCGGAGGTTGTCCAAATGTTTGGTGGTAACTCGGAGAAACTCGAGCGCGAGCTC
GAGCGCATGGCTCGCCGCAAGTTCCGTATCTGTGTCTCCATGCAGCGTTACGCCAAGTTCAGCAAGGACGAACGT
GAAAACACCGAATTCTTGCTCCGCGCTTACCCCGACCTGCAGATTGCATACTTGGATGAGGAGCCACCTCTCAAT
GAAGGCGACGAGCCCCGTATCTACTCGGCTTTGATCGATGGTCACTGTGAAATTCTCGAGAACAACTTGCGGAAG
CCCAAGTTCAGAATTCAGCTTTCTGGAAACCCCATTCTCGGTGACGGAAAGTCCGACAACCAGAACCATTGCATC
ATCTTCTACCGTGGTGAATACATCCAGCTTATTGACGCCAATCAAGACAACTACTTGGAAGAATGTTTGAAGATT
CGCAGTGTCCTGGCCGAGTTCGAGGAACTGACCACTGATAATGTTTCTCCATACACCCCTGGAATTGCCTCGCCT
GACGAGAACCCCGTTGCCATTTTGGGAGCCCGTGAATACATTTTCTCCGAGAGCGTCGGTGTTCTCGGTGATGTT
GCCGCCTCCAAGGAACAAACGTTCGGTACTCTTTTCGCTCGTACACTGGCTCAAATCGGTGGTAAGCTTCACTAT
GGTCATCCTGATTTCTTGAATGCCACTTTCATGACGACTCGTGGTGGTGTCTCCAAAGCCCAGAAAGGATTGCAC
TTGAACGAGGATATTTACGCTGGTATGACTGCTGTTCTCCGAGGAGGTCGCATCAAGCATTGTGAATATTATCAG
TGTGGTAAGGGTCGTGATCTTGGTTTCGGATCCGTTCTCAACTTCACCACGAAGATTGGTACTGGTATGGGTGAA
CAGATGCTTTCCCGAGAGTACTACTATCTCGGTACCCAGCTGCCCCTCGATCGCTTCCTCTCATTCTACTATGCT
CACCCTGGTTTCCATCTGAACAACATGTTCATTATGTTGTCTGTGCAAATGTTCATGTTTGTCCTGATCAACCTT
GGCGCCCTGAAGCACGAGACCATCATGTGCCGTTACAACTCCGACCTGCCTATTACCGATCCTCTTGTGCCTACT
CTCTGCGCCAACCTGATTCCAATCCTCAACTGGGTGAACCGCTGTGTTATCTCCATTTTCATTGTGTTCTTCATC
TCATGGGTTCCTCTTGCAGTCCAAGAGCTGACGGAGAGAGGAGTGTGGCGCATGGCTACTCGTCTGGGCAAGCAT
TTCGGTTCGTTCTCGTTCATGTTCGAGGTGTTCGTTTGTCAGATCTACGCCAACGCCGTGCACGCCAACTTGTCT
TTCGGTGGTGCGCGATACATTGGTACCGGTCGTGGTTTCGCAACGGCTCGTATCCCATTCGGTGTCCTCTACTCA
CGATTCGCTGGGCCTTCAATTTACCTGGGCGCTCGCCTCCTGCTGATGCTGTTGTTCAGTACCACAACGGTCTGG
ACTCCCGCTCTGATCTGGTTCTGGGTTTCCCTACTCGCGCTGAGCATTTCGCCTTTCCTGTTCAACCCCCACCAG
TTTGCCTGGACCGACTTCTTCATCGACTACCGCGACTACATCCGCTGGCTTTCTCGCGGTAACTCCCGATCCCAT
GCTTCCTCTTGGATCGGTTTCTGTCGCCTTTCGCGTACTCGTATCACTGGTTACAAGCGGAAAGTGCTTGGTGTT
CCATCGGAGAAAGGCTCCGGTGATATTCCTAGGGCGCGAATCACCAACATTTTCTTCGCCGAAATTGTTACGCCT
CTGCTTGGTGTTCTGGCAACAGGAATCCCGTACCTATACATCAACTCGCGGACAATGTATTCTGATGATCCCAAG
TGGGCTGCGAATCCCATCATTCGCCTTGCGATTATTGCTTTTGCCCCCGTCGGTATCAATGCCGGCGTCGCGGGT
ATGTTCTTCGGCATGGCTTGCTGTATGGGCCCATTGTTTGGCATGTGCTGCAAGAAGTTCGGTGCTGTCCTTGCT
GCTATTGCCCATGCCATCGCTGTGATTATCTTCCTCATCATCTTCCTGGCCATGTTCTTCCTGGAATCCCTCAGC
TGGCCCCGAACCATCTCTGGCATGATCGCTGCTATGGCTCTCCAGCGCTTCCTCTACAAGGTGATCATTGCCCTC
GCTCTGACCCGTGAATTCAAGAACGATCAATCCAATATTGCATGGTGGACCGGAAAATGGTACGGCATGGGTTGG
CACTCCCTTTCTCAGCCTGGACGTGAGTTCCTGTGCAAAATCACTGAACTTGGTTATTTCGCCAACGATTTCTTC
CTTGGCCATGTTCTCCTGTTTGCCATGCTCCCGGCCCTCGCCATTCCCTATGTCGACACCTTCCATTCGGTCATC
CTGTTTTGGCTGCGCCCAAGCTCTCAAATTCGCCCTCCTATCTACTCTCTCAAGCAGTCCAAGCTTCGCAAGAGA
CGCGTTGTTCGCTTCGCCATTCTCTACTTCTTCACGCTCTTCATCTTCCTCATTATTATCATTGCGCCTATTGTG
CTGCGAAATACGAAGCAATTGGATAGCATCTTGTCCGGCGGCATCTGGGACAGCCTGGGTGTCTCTAAGCCGTCT
TCGATTGGTCTTCTGCAACCACTTGATCACGGACTCAATGACACCGTCTCCTGGTACACTGGCTCTAATATCCCC
AAGGGCTACACCTCAGGCAGCATCCCAGCCGCCTCCGAGGGCACCGGAAAGTGGTCCATCTAA
Gene >Pro_DTO070G2_2|g4930.t1
ATGTCGGGCTACGCAGGCGGAGGCCAGTACGACGATGGCTATGCCCACGGGCAGGCACATGGTCAAGCTCATGGG
GATGCTCATGGTGACTCGTACTACCAGGACGAACATGCACAGGGTTATTATGACAACCAAGGGTATGGCGATGGC
TACTACGATCAAGGGTATAACCACCCCCACATCAGAAAATGGAGTCATGGGCTGACAAGACTAGTAATGGCTACT
ACGGAGCAGACGGTGTTCACGCCGACGGAGCTCCTGGGGATCATGCAGCTCACGCGGATGCAGGCCACGGATACG
CCGACGGCGGATACTACGAGGCTGGGCATATAGATCCCCACGCCGCAGAACCGTACTACGACCAGGGACAAGGGG
AACCCCGAGGCCGTCGTGGTCATGATTCCGAGGAGGATTCCGAGACCTTCAGCGATTTCACCATGAGGTCCGAGA
CTGCTCGGGCTGCGGACATGGACTACTATGGCCGTGGAGACGAGCGGTACAACAGCTACTCAGACAGCCAGTACG
GCGGTGCTGGTGGATACCGTCCTCCTTCCTCTCAAGTTTCCTACGGTGCCAACCGATCATCTGGCGCTTCAACTC
CTGTCTACGGAATGGATTACGGCAACGCCATTCCCGCCGGCCAGCGCTCGCGTGAGCCTTACCCGGCCTGGACTT
CGGAGGCCCAGATCCCTCTCTCAAAGGAGGAGCTCGAGGATATCTTCTTGGATCTGGTCAATAAGTTTGGATTCC
AGCGAGACAGCATGCGCAACATGTATGACCACATGATGACTATTCTGGACTCTCGTGCCTCGCGTATGACCCCCA
ACCAGGCACTTCTCTCCGTTCACGCCGACTACATCGGCGGCCAGAACGCTAATTATCGCCGATGGTACTTTGCCG
CCCATCTCGATCTCGATGATGCGGTCGGTTTCGCCAACATGAAGCTCGGCAAGGCAGACCGCAAGACGCGGAAGG
CTCGCAGGGCTGCAGCCAAGGCCGCCAAAGCTAACCCCGAGGACGAAGAGGAAACGCTCGAGGCTTTGGAAGGAG
ACAACAGCTTGGAAGCTGCGGAATACCGCTGGAAGTCTCGCATGAACCGGATGTCCCAGCACGACCGGGCCCGCC
AAGTTGCCCTCTATCTTCTGATCTGGGGTGAAGCCAACCAGGTGCGATTCCTGCCGGAGTGTATCTGTTTCATCT
TCAAGTGTGCCGACGATTACTACACTTCGCCCGAATGCCAGGCGCGCGTTGAACCGGTGGAGGAATTCACCTACC
TCAATGAGATCATCACTCCTCTCTACCATTACTGTCGAGACCAGGGATATGAAATCATGGACGGCAAGTATGTTC
GTCGTGAGCTCGATCACAACAACATCATTGGTTACGATGACATGAACCAACTGTTCTGGTACCCGGAGGGTATCG
AGCGCATCGGGTTTGAGGATAAGACCCGCCTGGTCGATATTCCTATCTCTGAAAGATGGCCCAAGTTGAAGGATG
TGGTCTGGAAGAATGCCTTCTTCAAGACTTTCAAGGAAACTCGCTCCTGGTTCCACATGATCACGAACTTCAACC
GTATCTGGGTTATCCACCTGGGTGCCTTCTGGTTCTTCACTGCCTACAACGCTCCAACTCTGTATACCATCAACT
ACCAACAACAGGTGGACAACAAGCCACCGACGGCTAAATACCTCGGCGCTGTCGGTTTCGGTGGTGCTCTTGTCT
CCTTCATTCAGATTCTAGCTACCATTTGTGAATGGATGTACGTTCCCCGACGGTGGGCTGGAGCGCAGCACCTGC
ACAAACGGTTCATGTTCCTCATTGTCATGTTCATTATCAACCTGGCTCCTGGAATCGTCATCTTCGCCATCTTGC
CCATGCTGAAAATGTCAACCAAGACAGAAAACGGCATCGGCCTCGCCATCGGTATTGTCCACTTTGTTATCGCAG
TCCTGACAGCCACTTTCTTCGCAATCCAGCCCTTGGGTGCGCTTTTCGGCAATTACATGAAGAAAGGTGGACGCC
AATACGTTGCCAGTCAGACCTTCACGGCTAGTTTCTATCGTCTTTCAGGTAACGACATGTGGATGTCATACGGCC
TCTGGGTCTGTGTGTTCGGTGCCAAGTTGGCGGAATCCTACTTCTTCTTGACGCTATCTTTCAAGGATCCCATCC
GCATCTTGTCCCCAATGCAGATCCACCAGTGTACTGGCGCGCAATACATTGGCAACACCCTTTGCCACCGACAGC
CTCAGATTCTTCTGGGCTTGATGGCTTTCATGGACTTGACACTTTTCTTCCTGGATAGTTACTTGTGGTACATTA
TTTGCAACACAATCTTCTCTGTGGCGCGATCATTCTATTTGGGTGTGTCAATTTGGTCACCGTGGAGAAACATCT
TCTCCCGCCTGCCGAAGCGTATCTACTCCAAGGTGCTTGCCACTACCGACATGGAGATCAAATACAAGCCCAAGG
TCTTGATCTCGCAAGTTTGGAATGCGATTATCATCTCCATGTACCGTGAGCATCTTCTCGCCATCGACCATGTGC
AGAAGCTGCTTTACCACCAGGTTCCCTCCGAGCAGGAAGGAAAGCGCACCCTCCGCGCCCCAACCTTCTTCGTGT
CACAGGAAGATCAATCTTTCAAGACTGAGTTCTTCCCACAGGGTAGTGAGGCCGAGCGTCGTATTTCGTTCTTCG
CCCAATCGCTCGCTACACCCATGCCCGAGCCTCTTCCCGTTGACAACATGCCCACTTTCACGGTCATGATTCCCC
ACTACAGTGAAAAGATCCTTTTGTCGCTCCGCGAGATTATCCGTGAAGATGAGCCTTACTCGCGTGTCACTTTGC
TGGAATACCTCAAGCAATTGCACCCTCACGAGTGGGATTGCTTCGTCAAGGATACCAAGATCCTCGCCGATGAGA
CTTCGCAGTTCAACGGTGATAATGAGAAGCCCGAGAAAGACGCTGCCAAGAGCAAGGTTGATGACCTGCCTTTCT
ACTGCATTGGTTTCAAGTCCGCCGCTCCCGAATATACCCTCCGCACCAGAATCTGGGCTTCCCTCCGATCCCAGA
CCTTGTACAGGACTATTTCTGGCTTCATGAATTACAGCCGTGCTATCAAGCTGCTTTACCGTGTCGAAAACCCGG
AGGTTGTCCAAATGTTTGGTGGTAACTCGGAGAAACTCGAGCGCGAGCTCGAGCGCATGGCTCGCCGCAAGTTCC
GTATCTGTGTCTCCATGCAGCGTTACGCCAAGTTCAGCAAGGACGAACGTGAAAACACCGAATTCTTGCTCCGCG
CTTACCCCGACCTGCAGATTGCATACTTGGATGAGGAGCCACCTCTCAATGAAGGCGACGAGCCCCGTATCTACT
CGGCTTTGATCGATGGTCACTGTGAAATTCTCGAGAACAACTTGCGGAAGCCCAAGTTCAGAATTCAGCTTTCTG
GAAACCCCATTCTCGGTGACGGAAAGTCCGACAACCAGAACCATTGCATCATCTTCTACCGTGGTGAATACATCC
AGCTTATTGACGCCAATCAAGACAACTACTTGGAAGAATGTTTGAAGATTCGCAGTGTCCTGGCCGAGTTCGAGG
AACTGACCACTGATAATGTTTCTCCATACACCCCTGGAATTGCCTCGCCTGACGAGAACCCCGTTGCCATTTTGG
GAGCCCGTGAATACATTTTCTCCGAGAGCGTCGGTGTTCTCGGTGATGTTGCCGCCTCCAAGGAACAAACGTTCG
GTACTCTTTTCGCTCGTACACTGGCTCAAATCGGTGGTAAGCTTCACTATGGTCATCCTGATTTCTTGAATGCCA
CTTTCATGACGACTCGTGGTGGTGTCTCCAAAGCCCAGAAAGGATTGCACTTGAACGAGGATATTTACGCTGGTA
TGACTGCTGTTCTCCGAGGAGGTCGCATCAAGCATTGTGAATATTATCAGTGTGGTAAGGGTCGTGATCTTGGTT
TCGGATCCGTTCTCAACTTCACCACGAAGATTGGTACTGGTATGGGTGAACAGATGCTTTCCCGAGAGTACTACT
ATCTCGGTACCCAGCTGCCCCTCGATCGCTTCCTCTCATTCTACTATGCTCACCCTGGTTTCCATCTGAACAACA
TGTTCATTATGTTGTCTGTGCAAATGTTCATGTTTGTCCTGATCAACCTTGGCGCCCTGAAGCACGAGACCATCA
TGTGCCGTTACAACTCCGACCTGCCTATTACCGATCCTCTTGTGCCTACTCTCTGCGCCAACCTGATTCCAATCC
TCAACTGGGTGAACCGCTGTGTTATCTCCATTTTCATTGTGTTCTTCATCTCATGGGTTCCTCTTGCAGTCCAAG
AGCTGACGGAGAGAGGAGTGTGGCGCATGGCTACTCGTCTGGGCAAGCATTTCGGTTCGTTCTCGTTCATGTTCG
AGGTGTTCGTTTGTCAGATCTACGCCAACGCCGTGCACGCCAACTTGTCTTTCGGTGGTGCGCGATACATTGGTA
CCGGTCGTGGTTTCGCAACGGCTCGTATCCCATTCGGTGTCCTCTACTCACGATTCGCTGGGCCTTCAATTTACC
TGGGCGCTCGCCTCCTGCTGATGCTGTTGTTCAGTACCACAACGGTCTGGACTCCCGCTCTGATCTGGTTCTGGG
TTTCCCTACTCGCGCTGAGCATTTCGCCTTTCCTGTTCAACCCCCACCAGTTTGCCTGGACCGACTTCTTCATCG
ACTACCGCGACTACATCCGCTGGCTTTCTCGCGGTAACTCCCGATCCCATGCTTCCTCTTGGATCGGTTTCTGTC
GCCTTTCGCGTACTCGTATCACTGGTTACAAGCGGAAAGTGCTTGGTGTTCCATCGGAGAAAGGCTCCGGTGATA
TTCCTAGGGCGCGAATCACCAACATTTTCTTCGCCGAAATTGTTACGCCTCTGCTTGGTGTTCTGGCAACAGGAA
TCCCGTACCTATACATCAACTCGCGGACAATGTATTCTGATGATCCCAAGTGGGCTGCGAATCCCATCATTCGCC
TTGCGATTATTGCTTTTGCCCCCGTCGGTATCAATGCCGGCGTCGCGGGTATGTTCTTCGGCATGGCTTGCTGTA
TGGGCCCATTGTTTGGCATGTGCTGCAAGAAGTTCGGTGCTGTCCTTGCTGCTATTGCCCATGCCATCGCTGTGA
TTATCTTCCTCATCATCTTCCTGGCCATGTTCTTCCTGGAATCCCTCAGCTGGCCCCGAACCATCTCTGGCATGA
TCGCTGCTATGGCTCTCCAGCGCTTCCTCTACAAGGTGATCATTGCCCTCGCTCTGACCCGTGAATTCAAGAACG
ATCAATCCAATATTGCATGGTGGACCGGAAAATGGTACGGCATGGGTTGGCACTCCCTTTCTCAGCCTGGACGTG
AGTTCCTGTGCAAAATCACTGAACTTGGTTATTTCGCCAACGATTTCTTCCTTGGCCATGTTCTCCTGTTTGCCA
TGCTCCCGGCCCTCGCCATTCCCTATGTCGACACCTTCCATTCGGTCATCCTGTTTTGGCTGCGCCCAAGGTATG
TAGCTCCTCATCTCCACACTACGAAAACTCTGTACTAACGAAGCATGCTTCTAGCTCTCAAATTCGCCCTCCTAT
CTACTCTCTCAAGCAGTCCAAGCTTCGCAAGAGACGCGTTGTTCGCTTCGCCATTCTCTACTTCTTCACGCTCTT
CATCTTCCTCATTATTATCATTGCGCCTATTGTGCTGCGAAATACGAAGCAATTGGATAGCATCTTGTCCGGCGG
CATCTGGGACAGCCTGGGTGTCTCTAAGCCGTCTTCGATTGGTCTTCTGCAACCACTTGATCACGGACTCAATGA
CACCGTCTCCTGGTACACTGGCTCTAATATCCCCAAGGGCTACACCTCAGGCAGCATCCCAGCCGCCTCCGAGGG
CACCGGAAAGTGGTCCATCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail