Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g4714.t1
Gene name
Locationscaffold_05:780120..781880
Strand-
Gene length (bp)1760
Transcript length (bp)1707
Coding sequence length (bp)1707
Protein length (aa) 569

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.8E-37 55 468
PF00083 Sugar_tr Sugar (and other) transporter 2.3E-09 85 225

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0006810 transport No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 45 64 19
2 86 108 22
3 115 137 22
4 141 163 22
5 175 197 22
6 202 224 22
7 257 276 19
8 286 308 22
9 328 350 22
10 365 387 22
11 394 416 22
12 421 438 17
13 451 473 22
14 524 546 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g4714.t1
MVINTSNDGHPADPEKQSKTSITVDREEYVPEADQSSAAICTSSWIAISLVVFSLALSMFLLGLDSTIVSTAIPE
ITNRFHALDDVGWYASAYMLTFCAIQLIWGKLYSFWSAKSVYLAALFIFEVGSLLCGVAPSSTAFIVGRAIAGAG
SGGVSAGSFVLVAHRVPLRHRASMVGIVSAAFGVGSIAGPLVGGAFTTNTQLTWRWCFYINLPLGLFVALVIFLC
IRPIKNAPNADIDQPQLFPQSSMKEKIRQMDLPGVSLLLPGVICLLLALQWGGTKYAWSSGRIVALLVLGPVLLL
AFASIQVFTKVQSHVTVPMRVVQNRNIWGSSMYGSCIVAAFFTLMYYLPIWFQAIKGASPVRSGIMTLPTIISFV
IFSTSGGALTSLAGCHAPFACLSVILIATGSGLLSTLEVHTGAGKWIGYQILFGAGSGLGIQTALTPAQALPVAD
IAIGTAIIMFCQNLTGSIMVSVAQNVFTNKLVRYLAEEVDGIDAQTVLSMGATEISDHIPSDQYGTVLKAYNKAL
THTFYVAVALSSAAVMGAVCLRWKPAMRSWMKHMRPGTEQHSL*
Coding >Pro_DTO070G2_2|g4714.t1
ATGGTCATCAACACCTCCAATGATGGTCATCCAGCAGACCCCGAAAAGCAGAGCAAGACATCAATTACAGTCGAT
AGGGAAGAATATGTTCCTGAAGCAGACCAATCCAGTGCCGCAATTTGCACTTCCAGCTGGATCGCAATATCACTG
GTGGTGTTCTCTCTCGCACTGTCCATGTTTCTACTCGGCTTGGATAGTACAATTGTGTCGACGGCAATACCTGAA
ATCACCAACCGGTTTCATGCTCTAGACGATGTGGGTTGGTATGCAAGCGCTTACATGTTGACCTTTTGCGCAATC
CAACTCATCTGGGGCAAGCTGTACTCATTCTGGTCCGCCAAGTCGGTTTATCTGGCTGCCTTGTTTATCTTTGAA
GTGGGATCATTGCTTTGCGGCGTCGCTCCATCCTCAACCGCATTCATTGTCGGTCGCGCAATTGCCGGTGCTGGT
AGTGGAGGTGTTAGCGCAGGATCTTTCGTGCTGGTTGCCCACCGAGTCCCTCTTAGACATCGCGCTTCCATGGTG
GGGATTGTCAGCGCGGCATTTGGCGTTGGCTCCATCGCAGGTCCTCTCGTAGGCGGCGCCTTCACAACTAATACG
CAATTGACATGGCGGTGGTGCTTCTATATCAACCTTCCGTTGGGGCTTTTCGTGGCCTTGGTGATATTCCTTTGT
ATTCGACCCATAAAGAACGCCCCCAATGCCGATATTGACCAACCGCAACTATTCCCTCAGTCGTCCATGAAAGAA
AAGATTCGCCAGATGGACCTTCCAGGGGTATCATTACTTCTCCCTGGTGTTATATGCTTGCTTCTAGCTCTACAG
TGGGGTGGGACAAAATACGCCTGGTCGAGCGGACGTATCGTTGCTCTCCTAGTTCTTGGACCAGTTCTCCTTCTC
GCCTTCGCTTCTATCCAAGTGTTCACCAAAGTGCAGTCCCATGTCACAGTCCCCATGCGGGTGGTCCAAAATAGG
AATATCTGGGGCTCATCAATGTACGGATCGTGTATCGTCGCTGCGTTTTTCACACTGATGTACTACCTCCCCATC
TGGTTCCAAGCAATCAAAGGTGCATCCCCGGTACGCTCGGGTATCATGACATTGCCCACAATTATTAGCTTCGTG
ATATTTTCCACCTCGGGCGGTGCGCTCACCTCTCTGGCGGGCTGTCACGCTCCCTTCGCCTGCCTTTCTGTTATC
TTGATCGCCACAGGATCAGGTCTCCTAAGTACACTGGAGGTACATACAGGGGCAGGTAAATGGATAGGATACCAG
ATCCTCTTCGGTGCGGGGTCGGGATTAGGAATCCAAACTGCTCTGACACCTGCCCAGGCTCTACCCGTCGCGGAT
ATTGCCATTGGCACAGCGATCATCATGTTCTGCCAGAACCTTACGGGTAGCATCATGGTTTCAGTTGCTCAGAAT
GTGTTTACCAATAAGTTGGTGAGGTATCTGGCGGAAGAGGTCGATGGAATAGATGCTCAGACCGTCTTGAGCATG
GGTGCAACAGAAATAAGTGACCATATACCCTCGGATCAATATGGCACGGTGCTGAAAGCATACAATAAGGCATTG
ACCCATACTTTCTACGTGGCAGTGGCCCTGTCTTCTGCAGCCGTGATGGGCGCTGTATGTCTGCGCTGGAAACCA
GCCATGCGTAGCTGGATGAAACATATGCGCCCCGGCACCGAACAGCATAGCTTGTAA
Transcript >Pro_DTO070G2_2|g4714.t1
ATGGTCATCAACACCTCCAATGATGGTCATCCAGCAGACCCCGAAAAGCAGAGCAAGACATCAATTACAGTCGAT
AGGGAAGAATATGTTCCTGAAGCAGACCAATCCAGTGCCGCAATTTGCACTTCCAGCTGGATCGCAATATCACTG
GTGGTGTTCTCTCTCGCACTGTCCATGTTTCTACTCGGCTTGGATAGTACAATTGTGTCGACGGCAATACCTGAA
ATCACCAACCGGTTTCATGCTCTAGACGATGTGGGTTGGTATGCAAGCGCTTACATGTTGACCTTTTGCGCAATC
CAACTCATCTGGGGCAAGCTGTACTCATTCTGGTCCGCCAAGTCGGTTTATCTGGCTGCCTTGTTTATCTTTGAA
GTGGGATCATTGCTTTGCGGCGTCGCTCCATCCTCAACCGCATTCATTGTCGGTCGCGCAATTGCCGGTGCTGGT
AGTGGAGGTGTTAGCGCAGGATCTTTCGTGCTGGTTGCCCACCGAGTCCCTCTTAGACATCGCGCTTCCATGGTG
GGGATTGTCAGCGCGGCATTTGGCGTTGGCTCCATCGCAGGTCCTCTCGTAGGCGGCGCCTTCACAACTAATACG
CAATTGACATGGCGGTGGTGCTTCTATATCAACCTTCCGTTGGGGCTTTTCGTGGCCTTGGTGATATTCCTTTGT
ATTCGACCCATAAAGAACGCCCCCAATGCCGATATTGACCAACCGCAACTATTCCCTCAGTCGTCCATGAAAGAA
AAGATTCGCCAGATGGACCTTCCAGGGGTATCATTACTTCTCCCTGGTGTTATATGCTTGCTTCTAGCTCTACAG
TGGGGTGGGACAAAATACGCCTGGTCGAGCGGACGTATCGTTGCTCTCCTAGTTCTTGGACCAGTTCTCCTTCTC
GCCTTCGCTTCTATCCAAGTGTTCACCAAAGTGCAGTCCCATGTCACAGTCCCCATGCGGGTGGTCCAAAATAGG
AATATCTGGGGCTCATCAATGTACGGATCGTGTATCGTCGCTGCGTTTTTCACACTGATGTACTACCTCCCCATC
TGGTTCCAAGCAATCAAAGGTGCATCCCCGGTACGCTCGGGTATCATGACATTGCCCACAATTATTAGCTTCGTG
ATATTTTCCACCTCGGGCGGTGCGCTCACCTCTCTGGCGGGCTGTCACGCTCCCTTCGCCTGCCTTTCTGTTATC
TTGATCGCCACAGGATCAGGTCTCCTAAGTACACTGGAGGTACATACAGGGGCAGGTAAATGGATAGGATACCAG
ATCCTCTTCGGTGCGGGGTCGGGATTAGGAATCCAAACTGCTCTGACACCTGCCCAGGCTCTACCCGTCGCGGAT
ATTGCCATTGGCACAGCGATCATCATGTTCTGCCAGAACCTTACGGGTAGCATCATGGTTTCAGTTGCTCAGAAT
GTGTTTACCAATAAGTTGGTGAGGTATCTGGCGGAAGAGGTCGATGGAATAGATGCTCAGACCGTCTTGAGCATG
GGTGCAACAGAAATAAGTGACCATATACCCTCGGATCAATATGGCACGGTGCTGAAAGCATACAATAAGGCATTG
ACCCATACTTTCTACGTGGCAGTGGCCCTGTCTTCTGCAGCCGTGATGGGCGCTGTATGTCTGCGCTGGAAACCA
GCCATGCGTAGCTGGATGAAACATATGCGCCCCGGCACCGAACAGCATAGCTTGTAA
Gene >Pro_DTO070G2_2|g4714.t1
ATGGTCATCAACACCTCCAATGATGGTCATCCAGCAGACCCCGAAAAGCAGAGCAAGACATCAATTACAGTCGAT
AGGGAAGAATATGTTCCTGAAGCAGACCAATCCAGTGCCGCAATTTGCACTTCCAGCTGGATCGCAATATCACTG
GTGGTGTTCTCTCTCGCACTGTCCATGTTTCTACTCGGCTTGGATAGTACAATTGTGTCGACGGCAATACCTGAA
ATCACCAACCGGTTTCATGCTCTAGACGATGTGGGTTGGTATGCAAGCGCTTACATGTTGACCTTTTGCGCAATC
CAACTCATCTGGGGCAAGCTGTACTCATTCTGGTCCGCCAAGTCGGTTTATCTGGCTGCCTTGTTTATCTTTGAA
GTGGGATCATTGCTTTGCGGCGTCGCTCCATCCTCAACCGCATTCATTGTCGGTCGCGCAATTGCCGGTGCTGGT
AGTGGAGGTGTTAGCGCAGGATCTTTCGTGCTGGTTGCCCACCGAGTCCCTCTTAGACATCGCGCTTCCATGGTG
GGGATTGTCAGCGCGGCATTTGGCGTTGGCTCCATCGCAGGTCCTCTCGTAGGCGGCGCCTTCACAACTAATACG
CAATTGACATGGCGGTGGTGCTTCTATATCAACCTTCCGTTGGGGCTTTTCGTGGCCTTGGTGATATTCCTTTGT
ATTCGACCCATAAAGAACGCCCCCAATGCCGATATTGACCAACCGCAACTATTCCCTCAGTCGTCCATGAAAGAA
AAGATTCGCCAGATGGACCTTCCAGGGGTATCATTACTTCTCCCTGGTGTTATATGCTTGCTTCTAGCTCTACAG
TGGGGTGGGACAAAATACGCCTGGTCGAGCGGACGTATCGTTGCTCTCCTAGTTCTTGGACCAGTTCTCCTTCTC
GCCTTCGCTTCTATCCAAGTGTTCACCAAAGTGCAGTCCCATGTCACAGTCCCCATGCGGGTGGTCCAAAATAGG
AATATCTGGGGCTCATCAATGTACGGATCGTGTATCGTCGCTGCGTTTTTCACACTGATGTACTACGTAAGTATC
GCCAATTCTTCATTGACCCGCGCCGCTAACGATGCGAACAATAGCTCCCCATCTGGTTCCAAGCAATCAAAGGTG
CATCCCCGGTACGCTCGGGTATCATGACATTGCCCACAATTATTAGCTTCGTGATATTTTCCACCTCGGGCGGTG
CGCTCACCTCTCTGGCGGGCTGTCACGCTCCCTTCGCCTGCCTTTCTGTTATCTTGATCGCCACAGGATCAGGTC
TCCTAAGTACACTGGAGGTACATACAGGGGCAGGTAAATGGATAGGATACCAGATCCTCTTCGGTGCGGGGTCGG
GATTAGGAATCCAAACTGCTCTGACACCTGCCCAGGCTCTACCCGTCGCGGATATTGCCATTGGCACAGCGATCA
TCATGTTCTGCCAGAACCTTACGGGTAGCATCATGGTTTCAGTTGCTCAGAATGTGTTTACCAATAAGTTGGTGA
GGTATCTGGCGGAAGAGGTCGATGGAATAGATGCTCAGACCGTCTTGAGCATGGGTGCAACAGAAATAAGTGACC
ATATACCCTCGGATCAATATGGCACGGTGCTGAAAGCATACAATAAGGCATTGACCCATACTTTCTACGTGGCAG
TGGCCCTGTCTTCTGCAGCCGTGATGGGCGCTGTATGTCTGCGCTGGAAACCAGCCATGCGTAGCTGGATGAAAC
ATATGCGCCCCGGCACCGAACAGCATAGCTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail