Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g4693.t1
Gene name
Locationscaffold_05:714660..717209
Strand+
Gene length (bp)2549
Transcript length (bp)2442
Coding sequence length (bp)2442
Protein length (aa) 814

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13688 Reprolysin_5 Metallo-peptidase family M12 1.9E-59 268 480
PF13583 Reprolysin_4 Metallo-peptidase family M12B Reprolysin-like 1.2E-48 269 489
PF13574 Reprolysin_2 Metallo-peptidase family M12B Reprolysin-like 1.3E-41 296 491
PF00200 Disintegrin Disintegrin 1.8E-17 521 595
PF13582 Reprolysin_3 Metallo-peptidase family M12B Reprolysin-like 2.5E-08 302 436

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 707 729 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g4693.t1
MRFSTILPLIGALSSLFQQTQARSQASNAIRRVTPVDNAIIRTPSHQIDHLSHFDITFALHQDGKRIKLELEPNN
DILADDAYVQYVRNDGTITHSEPIKRDEHKVFRGRALVGSGKGRWTPVGWARITVQRDGLEPLFEGAFSVNDDKH
HIELQSTYLDKKRPMDADVEPRDGPSMIVYRDSDMFRYTHSELKRSLPVSEGCGANNLGYNADLSNTIFGDMDSQ
WGVVSLNSMFGLSKRQSDVGGVSGNTGGVNLKSTIGDSSGCPKTKKVALIGVATDCEFTESFMATNSTPEQAARD
WVINVVNTASNLYEESFNVSIGLRNLTIAETGCSSSGSAATPWNVDCNGGNVTWRLNEFSKWRATHSDDNAYWTL
MTNCPTGSEVGVSWMGRLCSSELVTSGANSVAGANVVVRNSGSSWQVFAHETGHTFGAVHDCDESTCADNLEASS
QCCPLSSSTCNANAQYIMNPYAESTITKFSECTIGNICSAIGKNSIKSSCLSDNRGVVTISGSQCGNGIVEGDEE
CDCGDEESCSDNSCCDPKTCKFKGSAVCDDSNDSCCDQCQFASADTVCRASTGECDIAETCSGTSSSCPANKYKD
DGASCGAKDQGLSCASGQCTSRDYQCRTVTGAVLNTNDTWACDNTGSPSCSLVCGAPSSQQSMGATSCLIMNQNY
LDGTPCDSGGRCSAGQCKGSSALGWIRQHEKLVIGICVGVGTFLLLAIFFCIYSRCKRSAQLRKARKAIPPGTYR
RYNGPQPTARPPMDQWHGYRNAGYQNMPPPGYSGYQNVPPPGVPYQNGGYQNMPPPGPPPRYA*
Coding >Pro_DTO070G2_2|g4693.t1
ATGAGGTTTTCTACCATTCTGCCCTTGATCGGTGCACTGTCATCGCTCTTTCAACAAACACAAGCACGATCACAG
GCCTCAAACGCCATTCGCCGAGTGACGCCCGTCGACAATGCCATCATTCGTACTCCTTCACATCAAATAGATCAC
CTGTCACATTTTGATATCACGTTCGCCCTACACCAAGACGGCAAGCGCATAAAGCTAGAACTCGAGCCCAATAAT
GATATCTTGGCCGACGACGCTTATGTGCAATACGTCCGTAACGACGGCACAATAACACATTCTGAGCCGATCAAG
CGAGACGAGCACAAGGTTTTCCGCGGGCGCGCCTTGGTAGGATCCGGAAAGGGGAGATGGACGCCCGTAGGCTGG
GCAAGAATCACCGTCCAAAGGGATGGCCTCGAGCCTTTATTTGAAGGCGCTTTTAGTGTCAACGACGACAAGCAC
CACATTGAGCTGCAATCGACCTACCTCGACAAAAAGCGCCCGATGGATGCCGACGTCGAACCCAGAGATGGGCCA
TCGATGATCGTCTACCGTGACTCCGACATGTTTCGCTATACGCACTCCGAGCTCAAGCGGTCGCTGCCCGTATCT
GAAGGCTGCGGCGCTAATAACCTTGGATACAATGCTGATCTGTCCAATACGATTTTCGGGGATATGGACAGCCAA
TGGGGTGTGGTTTCGTTGAACTCGATGTTCGGATTAAGCAAGCGACAGTCCGATGTTGGTGGTGTCTCGGGAAAC
ACTGGCGGTGTGAATCTGAAATCGACCATCGGTGATTCCAGTGGATGTCCCAAAACGAAGAAAGTGGCCTTGATC
GGAGTTGCTACGGATTGTGAATTCACCGAATCCTTTATGGCTACAAACTCCACACCTGAACAAGCGGCTAGGGAC
TGGGTTATCAACGTGGTGAACACGGCTTCAAATCTCTATGAAGAATCTTTCAATGTGTCCATTGGTTTGCGCAAC
CTTACAATCGCCGAGACAGGCTGCTCTAGCTCGGGCTCCGCTGCTACGCCATGGAACGTGGATTGCAACGGCGGA
AATGTCACCTGGCGCCTGAATGAATTCTCCAAGTGGCGCGCAACTCATTCAGATGACAATGCCTACTGGACTCTG
ATGACTAACTGCCCAACGGGCTCCGAGGTTGGGGTTTCATGGATGGGTCGTCTATGCTCGTCCGAACTGGTTACC
TCTGGAGCGAACTCCGTGGCCGGTGCCAACGTCGTAGTGCGCAATTCCGGTTCTTCCTGGCAGGTGTTTGCCCAC
GAAACCGGTCACACCTTTGGAGCAGTGCACGATTGCGACGAGAGCACCTGCGCGGATAACCTGGAAGCCTCGTCT
CAATGCTGCCCGCTGAGTTCGTCAACCTGCAATGCCAATGCGCAATACATCATGAACCCCTATGCTGAGAGCACC
ATCACCAAGTTTTCGGAATGTACCATCGGTAACATCTGCTCTGCCATTGGCAAAAATAGCATCAAGTCCTCTTGT
CTATCCGACAACCGCGGCGTCGTGACCATCAGCGGCAGCCAATGCGGCAACGGCATCGTCGAAGGCGACGAGGAG
TGTGACTGCGGCGACGAAGAAAGCTGCAGCGACAACTCCTGCTGTGACCCCAAGACCTGCAAATTTAAAGGCAGC
GCCGTGTGCGATGACTCCAACGATAGCTGCTGCGATCAATGCCAGTTCGCCTCCGCCGACACCGTCTGCCGCGCC
AGCACCGGAGAATGCGACATCGCCGAGACCTGCAGCGGAACCTCGAGCTCTTGTCCCGCCAACAAATACAAAGAC
GACGGTGCCAGCTGCGGCGCCAAGGACCAGGGACTCAGCTGCGCCAGCGGCCAATGCACCAGCCGCGACTACCAG
TGCCGCACAGTAACAGGCGCGGTACTGAACACCAACGACACCTGGGCCTGCGATAACACAGGCAGTCCCTCCTGC
AGTCTCGTGTGCGGCGCACCCTCATCCCAACAATCAATGGGTGCCACAAGTTGCCTCATCATGAACCAGAACTAT
CTGGACGGTACACCCTGCGACTCCGGCGGCCGCTGCAGCGCCGGCCAGTGCAAGGGCTCCTCGGCCCTGGGCTGG
ATCCGGCAGCACGAGAAGCTGGTTATCGGCATCTGTGTCGGTGTCGGCACGTTCCTCCTGCTCGCTATCTTCTTC
TGTATCTATAGTCGTTGCAAGCGCAGTGCACAGCTGCGTAAGGCCCGCAAGGCTATCCCCCCTGGCACTTATCGC
CGCTATAATGGGCCCCAGCCTACTGCCCGCCCGCCTATGGACCAGTGGCATGGATACCGGAATGCCGGCTATCAG
AATATGCCTCCCCCTGGTTATTCCGGGTATCAGAATGTCCCTCCGCCTGGTGTCCCGTATCAAAACGGCGGGTAT
CAGAATATGCCTCCCCCTGGTCCCCCGCCACGATACGCATGA
Transcript >Pro_DTO070G2_2|g4693.t1
ATGAGGTTTTCTACCATTCTGCCCTTGATCGGTGCACTGTCATCGCTCTTTCAACAAACACAAGCACGATCACAG
GCCTCAAACGCCATTCGCCGAGTGACGCCCGTCGACAATGCCATCATTCGTACTCCTTCACATCAAATAGATCAC
CTGTCACATTTTGATATCACGTTCGCCCTACACCAAGACGGCAAGCGCATAAAGCTAGAACTCGAGCCCAATAAT
GATATCTTGGCCGACGACGCTTATGTGCAATACGTCCGTAACGACGGCACAATAACACATTCTGAGCCGATCAAG
CGAGACGAGCACAAGGTTTTCCGCGGGCGCGCCTTGGTAGGATCCGGAAAGGGGAGATGGACGCCCGTAGGCTGG
GCAAGAATCACCGTCCAAAGGGATGGCCTCGAGCCTTTATTTGAAGGCGCTTTTAGTGTCAACGACGACAAGCAC
CACATTGAGCTGCAATCGACCTACCTCGACAAAAAGCGCCCGATGGATGCCGACGTCGAACCCAGAGATGGGCCA
TCGATGATCGTCTACCGTGACTCCGACATGTTTCGCTATACGCACTCCGAGCTCAAGCGGTCGCTGCCCGTATCT
GAAGGCTGCGGCGCTAATAACCTTGGATACAATGCTGATCTGTCCAATACGATTTTCGGGGATATGGACAGCCAA
TGGGGTGTGGTTTCGTTGAACTCGATGTTCGGATTAAGCAAGCGACAGTCCGATGTTGGTGGTGTCTCGGGAAAC
ACTGGCGGTGTGAATCTGAAATCGACCATCGGTGATTCCAGTGGATGTCCCAAAACGAAGAAAGTGGCCTTGATC
GGAGTTGCTACGGATTGTGAATTCACCGAATCCTTTATGGCTACAAACTCCACACCTGAACAAGCGGCTAGGGAC
TGGGTTATCAACGTGGTGAACACGGCTTCAAATCTCTATGAAGAATCTTTCAATGTGTCCATTGGTTTGCGCAAC
CTTACAATCGCCGAGACAGGCTGCTCTAGCTCGGGCTCCGCTGCTACGCCATGGAACGTGGATTGCAACGGCGGA
AATGTCACCTGGCGCCTGAATGAATTCTCCAAGTGGCGCGCAACTCATTCAGATGACAATGCCTACTGGACTCTG
ATGACTAACTGCCCAACGGGCTCCGAGGTTGGGGTTTCATGGATGGGTCGTCTATGCTCGTCCGAACTGGTTACC
TCTGGAGCGAACTCCGTGGCCGGTGCCAACGTCGTAGTGCGCAATTCCGGTTCTTCCTGGCAGGTGTTTGCCCAC
GAAACCGGTCACACCTTTGGAGCAGTGCACGATTGCGACGAGAGCACCTGCGCGGATAACCTGGAAGCCTCGTCT
CAATGCTGCCCGCTGAGTTCGTCAACCTGCAATGCCAATGCGCAATACATCATGAACCCCTATGCTGAGAGCACC
ATCACCAAGTTTTCGGAATGTACCATCGGTAACATCTGCTCTGCCATTGGCAAAAATAGCATCAAGTCCTCTTGT
CTATCCGACAACCGCGGCGTCGTGACCATCAGCGGCAGCCAATGCGGCAACGGCATCGTCGAAGGCGACGAGGAG
TGTGACTGCGGCGACGAAGAAAGCTGCAGCGACAACTCCTGCTGTGACCCCAAGACCTGCAAATTTAAAGGCAGC
GCCGTGTGCGATGACTCCAACGATAGCTGCTGCGATCAATGCCAGTTCGCCTCCGCCGACACCGTCTGCCGCGCC
AGCACCGGAGAATGCGACATCGCCGAGACCTGCAGCGGAACCTCGAGCTCTTGTCCCGCCAACAAATACAAAGAC
GACGGTGCCAGCTGCGGCGCCAAGGACCAGGGACTCAGCTGCGCCAGCGGCCAATGCACCAGCCGCGACTACCAG
TGCCGCACAGTAACAGGCGCGGTACTGAACACCAACGACACCTGGGCCTGCGATAACACAGGCAGTCCCTCCTGC
AGTCTCGTGTGCGGCGCACCCTCATCCCAACAATCAATGGGTGCCACAAGTTGCCTCATCATGAACCAGAACTAT
CTGGACGGTACACCCTGCGACTCCGGCGGCCGCTGCAGCGCCGGCCAGTGCAAGGGCTCCTCGGCCCTGGGCTGG
ATCCGGCAGCACGAGAAGCTGGTTATCGGCATCTGTGTCGGTGTCGGCACGTTCCTCCTGCTCGCTATCTTCTTC
TGTATCTATAGTCGTTGCAAGCGCAGTGCACAGCTGCGTAAGGCCCGCAAGGCTATCCCCCCTGGCACTTATCGC
CGCTATAATGGGCCCCAGCCTACTGCCCGCCCGCCTATGGACCAGTGGCATGGATACCGGAATGCCGGCTATCAG
AATATGCCTCCCCCTGGTTATTCCGGGTATCAGAATGTCCCTCCGCCTGGTGTCCCGTATCAAAACGGCGGGTAT
CAGAATATGCCTCCCCCTGGTCCCCCGCCACGATACGCATGA
Gene >Pro_DTO070G2_2|g4693.t1
ATGAGGTTTTCTACCATTCTGCCCTTGATCGGTGCACTGTCATCGCTCTTTCAACAAACACAAGGTAAATCCCCA
CTTGCAGCCCAGACCGTCGTTGCCCAGGCCTCCGTTGCTCAGCCCGTTGCTCAGCCCGTTGCCTAGCTCCGTTGC
CTAGCCGCTGACAATCCCCAGCACGATCACAGGCCTCAAACGCCATTCGCCGAGTGACGCCCGTCGACAATGCCA
TCATTCGTACTCCTTCACATCAAATAGATCACCTGTCACATTTTGATATCACGTTCGCCCTACACCAAGACGGCA
AGCGCATAAAGCTAGAACTCGAGCCCAATAATGATATCTTGGCCGACGACGCTTATGTGCAATACGTCCGTAACG
ACGGCACAATAACACATTCTGAGCCGATCAAGCGAGACGAGCACAAGGTTTTCCGCGGGCGCGCCTTGGTAGGAT
CCGGAAAGGGGAGATGGACGCCCGTAGGCTGGGCAAGAATCACCGTCCAAAGGGATGGCCTCGAGCCTTTATTTG
AAGGCGCTTTTAGTGTCAACGACGACAAGCACCACATTGAGCTGCAATCGACCTACCTCGACAAAAAGCGCCCGA
TGGATGCCGACGTCGAACCCAGAGATGGGCCATCGATGATCGTCTACCGTGACTCCGACATGTTTCGCTATACGC
ACTCCGAGCTCAAGCGGTCGCTGCCCGTATCTGAAGGCTGCGGCGCTAATAACCTTGGATACAATGCTGATCTGT
CCAATACGATTTTCGGGGATATGGACAGCCAATGGGGTGTGGTTTCGTTGAACTCGATGTTCGGATTAAGCAAGC
GACAGTCCGATGTTGGTGGTGTCTCGGGAAACACTGGCGGTGTGAATCTGAAATCGACCATCGGTGATTCCAGTG
GATGTCCCAAAACGAAGAAAGTGGCCTTGATCGGAGTTGCTACGGATTGTGAATTCACCGAATCCTTTATGGCTA
CAAACTCCACACCTGAACAAGCGGCTAGGGACTGGGTTATCAACGTGGTGAACACGGCTTCAAATCTCTATGAAG
AATCTTTCAATGTGTCCATTGGTTTGCGCAACCTTACAATCGCCGAGACAGGCTGCTCTAGCTCGGGCTCCGCTG
CTACGCCATGGAACGTGGATTGCAACGGCGGAAATGTCACCTGGCGCCTGAATGAATTCTCCAAGTGGCGCGCAA
CTCATTCAGATGACAATGCCTACTGGACTCTGATGACTAACTGCCCAACGGGCTCCGAGGTTGGGGTTTCATGGA
TGGGTCGTCTATGCTCGTCCGAACTGGTTACCTCTGGAGCGAACTCCGTGGCCGGTGCCAACGTCGTAGTGCGCA
ATTCCGGTTCTTCCTGGCAGGTGTTTGCCCACGAAACCGGTCACACCTTTGGAGCAGTGCACGATTGCGACGAGA
GCACCTGCGCGGATAACCTGGAAGCCTCGTCTCAATGCTGCCCGCTGAGTTCGTCAACCTGCAATGCCAATGCGC
AATACATCATGAACCCCTATGCTGAGAGCACCATCACCAAGTTTTCGGAATGTACCATCGGTAACATCTGCTCTG
CCATTGGCAAAAATAGCATCAAGTCCTCTTGTCTATCCGACAACCGCGGCGTCGTGACCATCAGCGGCAGCCAAT
GCGGCAACGGCATCGTCGAAGGCGACGAGGAGTGTGACTGCGGCGACGAAGAAAGCTGCAGCGACAACTCCTGCT
GTGACCCCAAGACCTGCAAATTTAAAGGCAGCGCCGTGTGCGATGACTCCAACGATAGCTGCTGCGATCAATGCC
AGTTCGCCTCCGCCGACACCGTCTGCCGCGCCAGCACCGGAGAATGCGACATCGCCGAGACCTGCAGCGGAACCT
CGAGCTCTTGTCCCGCCAACAAATACAAAGACGACGGTGCCAGCTGCGGCGCCAAGGACCAGGGACTCAGCTGCG
CCAGCGGCCAATGCACCAGCCGCGACTACCAGTGCCGCACAGTAACAGGCGCGGTACTGAACACCAACGACACCT
GGGCCTGCGATAACACAGGCAGTCCCTCCTGCAGTCTCGTGTGCGGCGCACCCTCATCCCAACAATCAATGGGTG
CCACAAGTTGCCTCATCATGAACCAGAACTATCTGGACGGTACACCCTGCGACTCCGGCGGCCGCTGCAGCGCCG
GCCAGTGCAAGGGCTCCTCGGCCCTGGGCTGGATCCGGCAGCACGAGAAGCTGGTTATCGGCATCTGTGTCGGTG
TCGGCACGTTCCTCCTGCTCGCTATCTTCTTCTGTATCTATAGTCGTTGCAAGCGCAGTGCACAGCTGCGTAAGG
CCCGCAAGGCTATCCCCCCTGGCACTTATCGCCGCTATAATGGGCCCCAGCCTACTGCCCGCCCGCCTATGGACC
AGTGGCATGGATACCGGAATGCCGGCTATCAGAATATGCCTCCCCCTGGTTATTCCGGGTATCAGAATGTCCCTC
CGCCTGGTGTCCCGTATCAAAACGGCGGGTATCAGAATATGCCTCCCCCTGGTCCCCCGCCACGATACGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail