Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g4686.t1
Gene name
Locationscaffold_05:688997..691104
Strand-
Gene length (bp)2107
Transcript length (bp)2001
Coding sequence length (bp)2001
Protein length (aa) 667

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00245 Alk_phosphatase Alkaline phosphatase 7.8E-66 169 649
PF00884 Sulfatase Sulfatase 8.3E-07 370 506
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 2.3E-05 424 493

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0016791 phosphatase activity Yes
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0042578 phosphoric ester hydrolase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g4686.t1
MRASSISALACFVSFAAAQTFQRLGGCPDLGCIFPPDQVDFLAGQYFDIRLEVHSPVNGSEARVGSPDENFTFTI
AKKGNGKEKGKSAVTAAKYFKIDEPQLEKWNFTWYEDLFAQDADTPSLVNVTSKIYRRIALYEPGEYEATLTYYG
KQKTVANWFVRDLPTKRRAKNVVMFIGDGMTTNMITAARLIAHRSINGKYMTKMALDKFPVLGHQMTHSMDSFIT
DSANSATALYTGHKTTVNALGVYVDSSSDAFDDPKFETIAEIFRRQHPGSGIGIVSTAFLADATPAGLAAHTSDR
GEYDHVIGSYYEGLTKYEWTNWDGPDVLLGAGAEDFLESEETRDYYKLFAEKGYNVAWNNTALHSAPSNEKLLGV
FQKSNLATWLDRNVYQSNLYNQSNYPDGSDRDADDLPGLKDMTLKAIDVLHKRHRKDGWFLMAEAASIDKQMHTL
DYDRSLGELLELDDTVRATIEKLEKLGQLEDTLIIVTADHGHGFDVTGSVDTQYMEAQEDDRSKRNAVGYYENSG
LSQYTVAGSNALRYSEGVHFPAQWDPRYTLQAGVVTFPDHREDYRVHSEGPRTPATKDTKKGYVANYKDAVSGFM
VNGTLPLDAGQGVHSLTDVPVFARGPCQELFGGVYSSIDIFFNMAECLGLSEAKHSGKPPHGGKHN*
Coding >Pro_DTO070G2_2|g4686.t1
ATGCGCGCCTCTTCTATCTCCGCGCTGGCATGTTTTGTCTCGTTCGCGGCAGCCCAGACCTTCCAGCGGTTGGGT
GGTTGCCCTGACTTGGGATGTATCTTCCCACCTGATCAGGTCGACTTCCTAGCGGGTCAGTACTTCGACATCCGT
CTCGAAGTACACTCCCCCGTCAATGGGTCTGAAGCTCGTGTTGGATCGCCAGACGAGAACTTTACCTTCACCATC
GCCAAGAAGGGCAATGGAAAGGAGAAGGGTAAATCTGCTGTCACTGCAGCAAAGTACTTCAAGATTGATGAACCC
CAGTTGGAAAAGTGGAACTTCACATGGTATGAAGATCTGTTCGCACAGGACGCAGACACGCCTTCCCTTGTCAAT
GTGACCTCGAAAATCTACAGGAGAATCGCCCTTTATGAGCCCGGCGAATACGAGGCTACTCTGACCTACTACGGA
AAGCAGAAGACAGTCGCCAACTGGTTTGTTCGTGATCTTCCTACCAAGAGACGCGCGAAGAACGTCGTTATGTTC
ATCGGAGACGGCATGACCACCAACATGATTACTGCAGCACGTCTCATTGCCCACCGCAGTATCAACGGCAAATAC
ATGACAAAGATGGCATTGGACAAGTTCCCTGTGCTGGGTCACCAGATGACACACTCCATGGACTCTTTCATTACT
GATTCGGCCAACTCCGCAACGGCCCTTTACACCGGTCACAAGACTACCGTCAATGCTTTGGGTGTCTATGTGGAC
TCCTCCAGCGACGCTTTCGATGACCCGAAATTCGAGACAATCGCAGAGATCTTCCGTCGCCAGCACCCCGGTTCC
GGTATTGGCATTGTGTCAACTGCCTTTTTGGCAGATGCTACTCCTGCCGGTCTTGCTGCTCACACTAGCGACCGT
GGCGAATACGACCATGTCATCGGCTCATACTACGAAGGTCTGACCAAGTACGAGTGGACAAACTGGGATGGTCCC
GATGTGCTCCTTGGTGCCGGTGCAGAGGATTTCCTCGAGAGCGAGGAAACGCGTGACTACTACAAGCTGTTCGCC
GAGAAGGGTTACAACGTAGCCTGGAACAACACAGCGCTGCACAGCGCCCCAAGCAACGAGAAGCTGCTGGGTGTT
TTCCAGAAATCCAATCTCGCTACTTGGCTCGATCGCAACGTCTACCAGTCCAACCTCTACAACCAGAGCAACTAC
CCCGACGGTTCAGACCGCGACGCTGATGATCTCCCCGGACTCAAGGACATGACCCTCAAGGCAATCGACGTGCTC
CACAAGCGACACCGCAAGGATGGTTGGTTCCTGATGGCCGAGGCCGCCAGCATCGACAAGCAGATGCACACTCTG
GACTATGACCGGTCCCTAGGCGAACTGCTCGAGCTCGACGATACCGTGCGCGCAACAATCGAGAAACTCGAGAAG
CTTGGCCAGCTCGAAGACACCCTCATCATCGTCACAGCCGACCACGGCCACGGTTTCGACGTGACCGGCTCCGTC
GACACGCAGTACATGGAGGCGCAGGAGGACGACCGCAGCAAGCGCAATGCGGTTGGATACTATGAGAACTCTGGC
TTGTCGCAATACACCGTCGCCGGATCCAATGCCTTGCGGTACTCCGAAGGTGTCCACTTCCCTGCCCAGTGGGAC
CCCCGATACACCCTGCAAGCGGGTGTTGTTACTTTCCCTGATCACCGCGAGGATTACCGGGTTCACAGCGAGGGT
CCCCGTACTCCTGCTACAAAGGACACGAAGAAGGGATACGTTGCCAACTACAAGGATGCCGTGAGTGGCTTCATG
GTCAATGGAACTCTTCCCCTTGATGCAGGACAGGGAGTCCACTCTTTGACGGATGTGCCAGTCTTTGCCCGTGGC
CCGTGTCAGGAGCTGTTTGGAGGTGTTTACAGCTCGATTGACATATTTTTCAACATGGCGGAATGCCTGGGCTTG
TCAGAGGCGAAGCACAGTGGCAAGCCTCCCCACGGTGGAAAGCACAATTAG
Transcript >Pro_DTO070G2_2|g4686.t1
ATGCGCGCCTCTTCTATCTCCGCGCTGGCATGTTTTGTCTCGTTCGCGGCAGCCCAGACCTTCCAGCGGTTGGGT
GGTTGCCCTGACTTGGGATGTATCTTCCCACCTGATCAGGTCGACTTCCTAGCGGGTCAGTACTTCGACATCCGT
CTCGAAGTACACTCCCCCGTCAATGGGTCTGAAGCTCGTGTTGGATCGCCAGACGAGAACTTTACCTTCACCATC
GCCAAGAAGGGCAATGGAAAGGAGAAGGGTAAATCTGCTGTCACTGCAGCAAAGTACTTCAAGATTGATGAACCC
CAGTTGGAAAAGTGGAACTTCACATGGTATGAAGATCTGTTCGCACAGGACGCAGACACGCCTTCCCTTGTCAAT
GTGACCTCGAAAATCTACAGGAGAATCGCCCTTTATGAGCCCGGCGAATACGAGGCTACTCTGACCTACTACGGA
AAGCAGAAGACAGTCGCCAACTGGTTTGTTCGTGATCTTCCTACCAAGAGACGCGCGAAGAACGTCGTTATGTTC
ATCGGAGACGGCATGACCACCAACATGATTACTGCAGCACGTCTCATTGCCCACCGCAGTATCAACGGCAAATAC
ATGACAAAGATGGCATTGGACAAGTTCCCTGTGCTGGGTCACCAGATGACACACTCCATGGACTCTTTCATTACT
GATTCGGCCAACTCCGCAACGGCCCTTTACACCGGTCACAAGACTACCGTCAATGCTTTGGGTGTCTATGTGGAC
TCCTCCAGCGACGCTTTCGATGACCCGAAATTCGAGACAATCGCAGAGATCTTCCGTCGCCAGCACCCCGGTTCC
GGTATTGGCATTGTGTCAACTGCCTTTTTGGCAGATGCTACTCCTGCCGGTCTTGCTGCTCACACTAGCGACCGT
GGCGAATACGACCATGTCATCGGCTCATACTACGAAGGTCTGACCAAGTACGAGTGGACAAACTGGGATGGTCCC
GATGTGCTCCTTGGTGCCGGTGCAGAGGATTTCCTCGAGAGCGAGGAAACGCGTGACTACTACAAGCTGTTCGCC
GAGAAGGGTTACAACGTAGCCTGGAACAACACAGCGCTGCACAGCGCCCCAAGCAACGAGAAGCTGCTGGGTGTT
TTCCAGAAATCCAATCTCGCTACTTGGCTCGATCGCAACGTCTACCAGTCCAACCTCTACAACCAGAGCAACTAC
CCCGACGGTTCAGACCGCGACGCTGATGATCTCCCCGGACTCAAGGACATGACCCTCAAGGCAATCGACGTGCTC
CACAAGCGACACCGCAAGGATGGTTGGTTCCTGATGGCCGAGGCCGCCAGCATCGACAAGCAGATGCACACTCTG
GACTATGACCGGTCCCTAGGCGAACTGCTCGAGCTCGACGATACCGTGCGCGCAACAATCGAGAAACTCGAGAAG
CTTGGCCAGCTCGAAGACACCCTCATCATCGTCACAGCCGACCACGGCCACGGTTTCGACGTGACCGGCTCCGTC
GACACGCAGTACATGGAGGCGCAGGAGGACGACCGCAGCAAGCGCAATGCGGTTGGATACTATGAGAACTCTGGC
TTGTCGCAATACACCGTCGCCGGATCCAATGCCTTGCGGTACTCCGAAGGTGTCCACTTCCCTGCCCAGTGGGAC
CCCCGATACACCCTGCAAGCGGGTGTTGTTACTTTCCCTGATCACCGCGAGGATTACCGGGTTCACAGCGAGGGT
CCCCGTACTCCTGCTACAAAGGACACGAAGAAGGGATACGTTGCCAACTACAAGGATGCCGTGAGTGGCTTCATG
GTCAATGGAACTCTTCCCCTTGATGCAGGACAGGGAGTCCACTCTTTGACGGATGTGCCAGTCTTTGCCCGTGGC
CCGTGTCAGGAGCTGTTTGGAGGTGTTTACAGCTCGATTGACATATTTTTCAACATGGCGGAATGCCTGGGCTTG
TCAGAGGCGAAGCACAGTGGCAAGCCTCCCCACGGTGGAAAGCACAATTAG
Gene >Pro_DTO070G2_2|g4686.t1
ATGCGCGCCTCTTCTATCTCCGCGCTGGCATGTTTTGTCTCGTTCGCGGCAGCCCAGACCTTCCAGCGGTTGGGT
GGTTGCCCTGACTTGGGATGTATCTTCCCACCTGATCAGTATGTAACGTCTCAATTGTACCTAAGCTCTAGCCAC
TTATTACTATTTGCAGGGTCGACTTCCTAGCGGGTCAGTACTTCGACATCCGTCTCGAAGTACACTCCCCCGTCA
ATGGGTCTGAAGCTCGTGTTGGATCGCCAGACGAGAACTTTACCTTCACCATCGCCAAGAAGGGCAATGGAAAGG
AGAAGGGTAAATCTGCTGTCACTGCAGCAAAGTACTTCAAGATTGATGAACCCCAGTTGGAAAAGTGGAACTTCA
CATGGTATGAAGGTAATGACTTCCTATATTAAGCTCTCGGGGAACGCCTAAGCTAACTGGAACAGATCTGTTCGC
ACAGGACGCAGACACGCCTTCCCTTGTCAATGTGACCTCGAAAATCTACAGGAGAATCGCCCTTTATGAGCCCGG
CGAATACGAGGCTACTCTGACCTACTACGGAAAGCAGAAGACAGTCGCCAACTGGTTTGTTCGTGATCTTCCTAC
CAAGAGACGCGCGAAGAACGTCGTTATGTTCATCGGAGACGGCATGACCACCAACATGATTACTGCAGCACGTCT
CATTGCCCACCGCAGTATCAACGGCAAATACATGACAAAGATGGCATTGGACAAGTTCCCTGTGCTGGGTCACCA
GATGACACACTCCATGGACTCTTTCATTACTGATTCGGCCAACTCCGCAACGGCCCTTTACACCGGTCACAAGAC
TACCGTCAATGCTTTGGGTGTCTATGTGGACTCCTCCAGCGACGCTTTCGATGACCCGAAATTCGAGACAATCGC
AGAGATCTTCCGTCGCCAGCACCCCGGTTCCGGTATTGGCATTGTGTCAACTGCCTTTTTGGCAGATGCTACTCC
TGCCGGTCTTGCTGCTCACACTAGCGACCGTGGCGAATACGACCATGTCATCGGCTCATACTACGAAGGTCTGAC
CAAGTACGAGTGGACAAACTGGGATGGTCCCGATGTGCTCCTTGGTGCCGGTGCAGAGGATTTCCTCGAGAGCGA
GGAAACGCGTGACTACTACAAGCTGTTCGCCGAGAAGGGTTACAACGTAGCCTGGAACAACACAGCGCTGCACAG
CGCCCCAAGCAACGAGAAGCTGCTGGGTGTTTTCCAGAAATCCAATCTCGCTACTTGGCTCGATCGCAACGTCTA
CCAGTCCAACCTCTACAACCAGAGCAACTACCCCGACGGTTCAGACCGCGACGCTGATGATCTCCCCGGACTCAA
GGACATGACCCTCAAGGCAATCGACGTGCTCCACAAGCGACACCGCAAGGATGGTTGGTTCCTGATGGCCGAGGC
CGCCAGCATCGACAAGCAGATGCACACTCTGGACTATGACCGGTCCCTAGGCGAACTGCTCGAGCTCGACGATAC
CGTGCGCGCAACAATCGAGAAACTCGAGAAGCTTGGCCAGCTCGAAGACACCCTCATCATCGTCACAGCCGACCA
CGGCCACGGTTTCGACGTGACCGGCTCCGTCGACACGCAGTACATGGAGGCGCAGGAGGACGACCGCAGCAAGCG
CAATGCGGTTGGATACTATGAGAACTCTGGCTTGTCGCAATACACCGTCGCCGGATCCAATGCCTTGCGGTACTC
CGAAGGTGTCCACTTCCCTGCCCAGTGGGACCCCCGATACACCCTGCAAGCGGGTGTTGTTACTTTCCCTGATCA
CCGCGAGGATTACCGGGTTCACAGCGAGGGTCCCCGTACTCCTGCTACAAAGGACACGAAGAAGGGATACGTTGC
CAACTACAAGGATGCCGTGAGTGGCTTCATGGTCAATGGAACTCTTCCCCTTGATGCAGGACAGGGAGTCCACTC
TTTGACGGATGTGCCAGTCTTTGCCCGTGGCCCGTGTCAGGAGCTGTTTGGAGGTGTTTACAGCTCGATTGACAT
ATTTTTCAACATGGCGGAATGCCTGGGCTTGTCAGAGGCGAAGCACAGTGGCAAGCCTCCCCACGGTGGAAAGCA
CAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail