Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g4586.t1
Gene name
Locationscaffold_05:401185..403330
Strand-
Gene length (bp)2145
Transcript length (bp)2019
Coding sequence length (bp)2019
Protein length (aa) 673

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05199 GMC_oxred_C GMC oxidoreductase 1.9E-29 520 663
PF00732 GMC_oxred_N GMC oxidoreductase 4.4E-05 142 213
PF00732 GMC_oxred_N GMC oxidoreductase 1.3E-17 313 417

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0016491 oxidoreductase activity No
GO:0000166 nucleotide binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g4586.t1
MRFPVVVGLFSTLSIVSAIDHRPDHRYHDAHRRSSDNSTTEYDYVVVGSGAGGGPVAARLAIAGYKVLLLEAGDD
QGNATQQIVPALQLQSTEYEPMRWDYFVNHYSNLTRQEEDSKMTYRTPAGDLHVGSNAPNGSEPLGILYPRAGTL
GGCSAHNAMITIYPYENDWEQLASLTGNDSWSASNMRQYFERLERNRYLPSSIIGHGFDGWLTTSLTDLRLVIED
QKLLSLILAGATAAGQTLLGKLITTVTGLARVLLRDLNNPLPSRDYEEGPYQVPLAVDVPEYKRTGPREFLMKTV
NAVNSDGSRKYHLDIQLNTLVTKLRFDTTGAKPRATGVDYLRGQSLYRADPRASQTSSNGTPGSVSASREVILSA
GSFNTPQLLKLSGIGPKEELSKFGISTLVNLPGVGRNLQDRYEIGTVGKSPTDFVLTSKCTFLYSLPDPCLEQYE
NNPLFKGTYTTNGIAIAIIRKSSVAEDEPDLLISGAPVNFPGYYPNYSYEGLKDAQHWTWITLKSRSRNNAGTVE
LRSTDPRDMPLINFHSFDTGVTTDGADDKDLQAVYEAMQFSRTIFDDLIPLDGGFEEVWPGPNVTTENELKDFIK
KEAWGHHACCTAAIGEDGDPQAVLDADFRVRGVDGLRVVDASVFPKIPGYYIALPIYMISEKAAEVIIADAV*
Coding >Pro_DTO070G2_2|g4586.t1
ATGCGTTTTCCTGTGGTAGTTGGGCTATTTTCCACTCTTTCAATTGTCTCAGCTATTGATCATAGACCGGATCAT
CGATATCATGATGCACACAGGAGGTCTTCGGATAACTCCACCACAGAATATGATTATGTTGTTGTTGGCTCTGGC
GCCGGAGGTGGCCCTGTAGCGGCACGATTGGCCATTGCAGGCTACAAGGTTCTTCTTCTAGAAGCAGGAGATGAC
CAGGGAAATGCGACTCAGCAAATTGTCCCCGCTCTGCAGCTCCAGTCCACCGAATACGAGCCGATGAGATGGGAT
TATTTCGTGAATCACTACTCGAACTTGACTCGTCAGGAAGAAGACAGCAAAATGACTTACCGGACACCTGCTGGT
GACCTCCATGTTGGAAGCAATGCGCCCAATGGGTCTGAACCTTTGGGAATTTTATACCCTCGAGCCGGTACTTTA
GGTGGATGCTCTGCTCATAATGCCATGATCACGATCTACCCGTACGAGAATGACTGGGAGCAACTGGCCAGTCTC
ACTGGCAATGATTCATGGTCTGCCTCGAATATGCGACAATACTTCGAGAGACTAGAGCGCAACCGATACCTTCCC
AGCAGCATCATAGGCCACGGATTCGACGGATGGCTTACAACGAGCCTCACAGACCTGCGTCTTGTCATTGAAGAC
CAAAAGCTTCTGTCCTTGATCCTGGCCGGTGCGACCGCCGCGGGTCAAACACTGCTGGGCAAACTGATCACTACG
GTCACGGGCCTCGCCCGAGTTCTGCTGCGTGATCTTAACAACCCCCTTCCTTCGCGTGACTACGAGGAGGGTCCA
TACCAAGTCCCTCTCGCCGTAGATGTCCCCGAATATAAGCGGACAGGTCCTCGAGAATTCCTCATGAAGACAGTC
AATGCTGTAAACTCGGATGGTTCGCGAAAGTATCACCTTGATATCCAGTTGAACACCTTGGTAACCAAGCTCCGG
TTCGATACCACCGGAGCGAAGCCACGGGCTACCGGTGTTGACTATCTTCGAGGACAGAGCCTCTACCGTGCAGAC
CCCCGGGCTTCCCAGACATCGTCTAATGGAACACCGGGTAGCGTGAGTGCTTCTCGTGAAGTGATCCTGTCTGCA
GGCTCATTCAACACCCCCCAGCTGCTGAAGCTGAGTGGTATTGGCCCAAAGGAGGAGTTGTCCAAATTTGGAATC
TCAACCCTGGTGAATCTCCCCGGCGTCGGTCGTAATCTTCAGGATCGGTACGAAATAGGTACAGTGGGCAAGTCA
CCCACCGATTTCGTCCTCACATCGAAGTGTACCTTTTTGTATTCTCTTCCCGACCCCTGTTTGGAACAGTATGAA
AACAATCCTTTGTTCAAAGGTACATATACCACCAATGGAATCGCCATCGCCATCATTCGCAAGTCGTCTGTTGCA
GAAGATGAGCCCGACCTACTGATCTCAGGAGCACCCGTCAACTTCCCCGGCTATTATCCCAACTACTCCTACGAG
GGTCTCAAAGATGCCCAGCACTGGACCTGGATTACGTTAAAGTCGCGCTCTCGCAATAACGCTGGTACAGTTGAG
TTGCGCTCTACCGACCCGCGTGACATGCCCCTTATCAACTTCCACTCGTTCGATACCGGAGTGACCACAGATGGT
GCAGATGACAAGGACCTGCAGGCTGTATATGAAGCAATGCAGTTCTCCCGCACAATATTCGATGACCTTATTCCC
CTTGATGGCGGGTTTGAAGAGGTCTGGCCGGGACCCAATGTCACTACTGAGAATGAACTGAAAGACTTCATTAAA
AAAGAGGCATGGGGTCACCATGCCTGCTGTACTGCTGCAATTGGAGAAGATGGAGATCCTCAGGCTGTGTTGGAT
GCGGACTTCCGTGTTCGTGGGGTTGACGGCTTGCGTGTTGTGGATGCTTCGGTCTTTCCTAAGATTCCAGGTTAC
TATATCGCCCTACCCATCTATATGATCAGTGAGAAGGCTGCCGAGGTTATCATTGCAGATGCCGTATGA
Transcript >Pro_DTO070G2_2|g4586.t1
ATGCGTTTTCCTGTGGTAGTTGGGCTATTTTCCACTCTTTCAATTGTCTCAGCTATTGATCATAGACCGGATCAT
CGATATCATGATGCACACAGGAGGTCTTCGGATAACTCCACCACAGAATATGATTATGTTGTTGTTGGCTCTGGC
GCCGGAGGTGGCCCTGTAGCGGCACGATTGGCCATTGCAGGCTACAAGGTTCTTCTTCTAGAAGCAGGAGATGAC
CAGGGAAATGCGACTCAGCAAATTGTCCCCGCTCTGCAGCTCCAGTCCACCGAATACGAGCCGATGAGATGGGAT
TATTTCGTGAATCACTACTCGAACTTGACTCGTCAGGAAGAAGACAGCAAAATGACTTACCGGACACCTGCTGGT
GACCTCCATGTTGGAAGCAATGCGCCCAATGGGTCTGAACCTTTGGGAATTTTATACCCTCGAGCCGGTACTTTA
GGTGGATGCTCTGCTCATAATGCCATGATCACGATCTACCCGTACGAGAATGACTGGGAGCAACTGGCCAGTCTC
ACTGGCAATGATTCATGGTCTGCCTCGAATATGCGACAATACTTCGAGAGACTAGAGCGCAACCGATACCTTCCC
AGCAGCATCATAGGCCACGGATTCGACGGATGGCTTACAACGAGCCTCACAGACCTGCGTCTTGTCATTGAAGAC
CAAAAGCTTCTGTCCTTGATCCTGGCCGGTGCGACCGCCGCGGGTCAAACACTGCTGGGCAAACTGATCACTACG
GTCACGGGCCTCGCCCGAGTTCTGCTGCGTGATCTTAACAACCCCCTTCCTTCGCGTGACTACGAGGAGGGTCCA
TACCAAGTCCCTCTCGCCGTAGATGTCCCCGAATATAAGCGGACAGGTCCTCGAGAATTCCTCATGAAGACAGTC
AATGCTGTAAACTCGGATGGTTCGCGAAAGTATCACCTTGATATCCAGTTGAACACCTTGGTAACCAAGCTCCGG
TTCGATACCACCGGAGCGAAGCCACGGGCTACCGGTGTTGACTATCTTCGAGGACAGAGCCTCTACCGTGCAGAC
CCCCGGGCTTCCCAGACATCGTCTAATGGAACACCGGGTAGCGTGAGTGCTTCTCGTGAAGTGATCCTGTCTGCA
GGCTCATTCAACACCCCCCAGCTGCTGAAGCTGAGTGGTATTGGCCCAAAGGAGGAGTTGTCCAAATTTGGAATC
TCAACCCTGGTGAATCTCCCCGGCGTCGGTCGTAATCTTCAGGATCGGTACGAAATAGGTACAGTGGGCAAGTCA
CCCACCGATTTCGTCCTCACATCGAAGTGTACCTTTTTGTATTCTCTTCCCGACCCCTGTTTGGAACAGTATGAA
AACAATCCTTTGTTCAAAGGTACATATACCACCAATGGAATCGCCATCGCCATCATTCGCAAGTCGTCTGTTGCA
GAAGATGAGCCCGACCTACTGATCTCAGGAGCACCCGTCAACTTCCCCGGCTATTATCCCAACTACTCCTACGAG
GGTCTCAAAGATGCCCAGCACTGGACCTGGATTACGTTAAAGTCGCGCTCTCGCAATAACGCTGGTACAGTTGAG
TTGCGCTCTACCGACCCGCGTGACATGCCCCTTATCAACTTCCACTCGTTCGATACCGGAGTGACCACAGATGGT
GCAGATGACAAGGACCTGCAGGCTGTATATGAAGCAATGCAGTTCTCCCGCACAATATTCGATGACCTTATTCCC
CTTGATGGCGGGTTTGAAGAGGTCTGGCCGGGACCCAATGTCACTACTGAGAATGAACTGAAAGACTTCATTAAA
AAAGAGGCATGGGGTCACCATGCCTGCTGTACTGCTGCAATTGGAGAAGATGGAGATCCTCAGGCTGTGTTGGAT
GCGGACTTCCGTGTTCGTGGGGTTGACGGCTTGCGTGTTGTGGATGCTTCGGTCTTTCCTAAGATTCCAGGTTAC
TATATCGCCCTACCCATCTATATGATCAGTGAGAAGGCTGCCGAGGTTATCATTGCAGATGCCGTATGA
Gene >Pro_DTO070G2_2|g4586.t1
ATGCGTTTTCCTGTGGTAGTTGGGCTATTTTCCACTCTTTCAATTGTCTCAGCTATGTAGGTACACCTTCAGTCT
CTACCTAGATCTTGTTGACACGGAAAACTAACATAATATAGTGATCATAGACCGGATCATCGATATCATGATGCA
CACAGGAGGTCTTCGGATAACTCCACCACAGAATATGATTATGTTGTTGTTGGCTCTGGCGCCGGAGGTGGCCCT
GTAGCGGCACGATTGGCCATTGCAGGCTACAAGGTTCTTCTTCTAGAAGCAGGAGATGACCAGGGAAATGCGACT
CAGCAAATTGTCCCCGCTCTGCAGCTCCAGTCCACCGAATACGAGCCGATGAGATGGGATTATTTCGTGAATCAC
TACTCGAACTTGACTCGTCAGGAAGAAGACAGCAAAATGACTTACCGGACACCTGCTGGTGACCTCCATGTTGGA
AGCAATGCGCCCAATGGGTCTGAACCTTTGGGAATTTTATACCCTCGAGCCGGTACTTTAGGTGGATGCTCTGCT
CATAATGCCATGATGTGAGCCATATCTTCTCCGCATGTCTATCGGATGTATCTGTCATATACTGACCAGTATCTT
TATAGCACGATCTACCCGTACGAGAATGACTGGGAGCAACTGGCCAGTCTCACTGGCAATGATTCATGGTCTGCC
TCGAATATGCGACAATACTTCGAGAGACTAGAGCGCAACCGATACCTTCCCAGCAGCATCATAGGCCACGGATTC
GACGGATGGCTTACAACGAGCCTCACAGACCTGCGTCTTGTCATTGAAGACCAAAAGCTTCTGTCCTTGATCCTG
GCCGGTGCGACCGCCGCGGGTCAAACACTGCTGGGCAAACTGATCACTACGGTCACGGGCCTCGCCCGAGTTCTG
CTGCGTGATCTTAACAACCCCCTTCCTTCGCGTGACTACGAGGAGGGTCCATACCAAGTCCCTCTCGCCGTAGAT
GTCCCCGAATATAAGCGGACAGGTCCTCGAGAATTCCTCATGAAGACAGTCAATGCTGTAAACTCGGATGGTTCG
CGAAAGTATCACCTTGATATCCAGTTGAACACCTTGGTAACCAAGCTCCGGTTCGATACCACCGGAGCGAAGCCA
CGGGCTACCGGTGTTGACTATCTTCGAGGACAGAGCCTCTACCGTGCAGACCCCCGGGCTTCCCAGACATCGTCT
AATGGAACACCGGGTAGCGTGAGTGCTTCTCGTGAAGTGATCCTGTCTGCAGGCTCATTCAACACCCCCCAGCTG
CTGAAGCTGAGTGGTATTGGCCCAAAGGAGGAGTTGTCCAAATTTGGAATCTCAACCCTGGTGAATCTCCCCGGC
GTCGGTCGTAATCTTCAGGATCGGTACGAAATAGGTACAGTGGGCAAGTCACCCACCGATTTCGTCCTCACATCG
AAGTGTACCTTTTTGTATTCTCTTCCCGACCCCTGTTTGGAACAGTATGAAAACAATCCTTTGTTCAAAGGTACA
TATACCACCAATGGAATCGCCATCGCCATCATTCGCAAGTCGTCTGTTGCAGAAGATGAGCCCGACCTACTGATC
TCAGGAGCACCCGTCAACTTCCCCGGCTATTATCCCAACTACTCCTACGAGGGTCTCAAAGATGCCCAGCACTGG
ACCTGGATTACGTTAAAGTCGCGCTCTCGCAATAACGCTGGTACAGTTGAGTTGCGCTCTACCGACCCGCGTGAC
ATGCCCCTTATCAACTTCCACTCGTTCGATACCGGAGTGACCACAGATGGTGCAGATGACAAGGACCTGCAGGCT
GTATATGAAGCAATGCAGTTCTCCCGCACAATATTCGATGACCTTATTCCCCTTGATGGCGGGTTTGAAGAGGTC
TGGCCGGGACCCAATGTCACTACTGAGAATGAACTGAAAGACTTCATTAAAAAAGAGGCATGGGGTCACCATGCC
TGCTGTACTGCTGCAATTGGAGAAGATGGAGATCCTCAGGCTGTGTTGGATGCGGACTTCCGTGTTCGTGGGGTT
GACGGCTTGCGTGTTGTGGATGCTTCGGTCTTTCCTAAGATTCCAGGTTACTATATCGCCCTACCCATCTATATG
ATCAGTGAGAAGGCTGCCGAGGTTATCATTGCAGATGCCGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail