Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g4454.t1
Gene name
Locationscaffold_04:1723309..1725365
Strand+
Gene length (bp)2056
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04086 SRP-alpha_N Signal recognition particle, alpha subunit, N-terminal 6.5E-78 26 304
PF00448 SRP54 SRP54-type protein, GTPase domain 1.9E-50 438 646
PF02881 SRP54_N SRP54-type protein, helical bundle domain 2.2E-08 333 399
PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB 2.4E-07 432 540

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0006614 SRP-dependent cotranslational protein targeting to membrane Yes
GO:0005785 signal recognition particle receptor complex Yes
GO:0003924 GTPase activity Yes
GO:0005047 signal recognition particle binding Yes
GO:0006886 intracellular protein transport Yes
GO:0006612 protein targeting to membrane No
GO:0071705 nitrogen compound transport No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0015031 protein transport No
GO:0009987 cellular process No
GO:0017076 purine nucleotide binding No
GO:0043168 anion binding No
GO:0045047 protein targeting to ER No
GO:0005575 cellular_component No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032553 ribonucleotide binding No
GO:0008104 protein localization No
GO:0072657 protein localization to membrane No
GO:0019001 guanyl nucleotide binding No
GO:0051649 establishment of localization in cell No
GO:0098796 membrane protein complex No
GO:0070972 protein localization to endoplasmic reticulum No
GO:0006605 protein targeting No
GO:0006810 transport No
GO:0097367 carbohydrate derivative binding No
GO:0051179 localization No
GO:0045184 establishment of protein localization No
GO:1901265 nucleoside phosphate binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0032991 protein-containing complex No
GO:0032555 purine ribonucleotide binding No
GO:0033036 macromolecule localization No
GO:0051641 cellular localization No
GO:0070727 cellular macromolecule localization No
GO:0033365 protein localization to organelle No
GO:0003824 catalytic activity No
GO:0044877 protein-containing complex binding No
GO:0046907 intracellular transport No
GO:0043021 ribonucleoprotein complex binding No
GO:0051234 establishment of localization No
GO:0072594 establishment of protein localization to organelle No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0051668 localization within membrane No
GO:0005488 binding No
GO:0090150 establishment of protein localization to membrane No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0043167 ion binding No
GO:0016787 hydrolase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0072599 establishment of protein localization to endoplasmic reticulum No
GO:0017111 nucleoside-triphosphatase activity No
GO:0006613 cotranslational protein targeting to membrane No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup8314
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g9069.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g8953.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g9240.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g6524.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g4117.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g3272.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g9107.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g5540.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g8749.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g7699.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g4237.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g7507.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g5760.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g4590.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g9687.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g6934.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g6801.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g7406.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g4454.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g8868.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g8893.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g5211.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g8594.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g4533.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g5665.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g8317.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g5799.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g7533.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g7464.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g7551.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g4255.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g8834.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g9697.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g6952.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g4454.t1
MLEAFEILTTSGVVLWSKAYAPVGAHVINSLINDVFIEEKVVPQNATTNGISPAYKKEKYTLKWKRVKEFDLIFV
AVYQSLLHLGWIDKLLENISTIFIDLYKDQVKGNRARIQTYRFDQYFEQQVRELEDNAGGFVEEHVPETGEKKDP
LVSSDNGGPPPPPVPGLVKAQPRAALAGATSDEGTPPATPEISRSSTPQGHLLTAKAGPGGRGSRRSRKAANSNA
NASSGDEARKGKPVKSPVKKMRRWDASGMADEDDGEILDYSAPAEEGETVAPAVEAVSEEDWGRRTGKGQFVLKE
LGEEVQSILDQADAEKSKGTASSGVVGSGFNAIGGFFRNIVGGKVLTESDLEKPLKAMEEHLLKKNVAREAAVRL
CEGVKLEMIGKKTGNFQSTDAALHVAMESSLRKILTPTSSLDLLREINAVVAPTTKQQAPRPYVMSIVGVNGVGK
STNLSKICYFLLQNKYRVLIAACDTFRSGAVEQLRVHADRLKELSVRENAGDVEIYQKGYGKDAANVAKDAVEYA
AANKFDVVLIDTAGRRHNDQRLMSSLEKFAKFANPDKIFMVGEALVGTDSVMQARNFNQAFGTGRNLDGFIISKC
DTVGDMVGTLVSMVHATGIPIVFLGVGQHYGDLRGLSVPWAVSLLMK*
Coding >Pro_DTO070G2_2|g4454.t1
ATGTTGGAGGCTTTTGAAATTTTAACCACATCGGGCGTGGTGCTTTGGTCTAAGGCCTACGCTCCGGTGGGCGCA
CATGTTATCAACAGCCTGATCAACGATGTCTTTATCGAGGAGAAGGTCGTGCCGCAGAATGCTACAACTAATGGG
ATCTCGCCGGCATACAAGAAGGAGAAATATACACTGAAATGGAAGAGAGTCAAGGAATTCGATTTGATCTTCGTG
GCCGTCTACCAATCGCTACTCCACCTTGGCTGGATAGACAAACTTCTTGAGAACATTTCAACCATCTTTATTGAT
CTCTACAAGGACCAGGTGAAGGGAAACCGCGCGAGAATCCAGACCTATCGGTTCGATCAATACTTTGAACAGCAA
GTTCGGGAGCTTGAAGACAACGCTGGTGGATTCGTAGAAGAACATGTGCCAGAGACGGGTGAAAAGAAAGACCCG
CTTGTTTCGTCGGACAATGGAGGCCCACCGCCGCCACCGGTGCCTGGCCTGGTGAAAGCGCAGCCCAGAGCTGCG
CTAGCCGGGGCGACCTCTGATGAGGGTACGCCACCAGCTACACCAGAAATTTCTAGATCTTCGACCCCTCAGGGT
CATCTTCTTACAGCCAAAGCCGGGCCTGGAGGTCGTGGCTCTCGACGTTCCCGCAAGGCTGCCAATTCGAACGCC
AACGCATCGTCTGGTGATGAAGCCCGGAAGGGAAAGCCTGTCAAGTCCCCTGTGAAGAAGATGCGCAGATGGGAT
GCTAGTGGGATGGCAGATGAGGATGACGGAGAAATCCTCGATTATTCTGCCCCCGCGGAGGAAGGAGAGACCGTC
GCCCCTGCGGTGGAGGCTGTCTCCGAGGAGGATTGGGGTCGTCGAACCGGCAAGGGCCAATTCGTGCTGAAAGAG
TTGGGCGAGGAAGTTCAATCCATCTTGGACCAAGCTGATGCTGAAAAGTCCAAAGGTACTGCTTCGTCTGGTGTG
GTTGGCTCCGGGTTCAACGCAATTGGTGGCTTCTTCCGTAACATCGTCGGAGGAAAGGTTCTGACAGAATCTGAT
CTCGAGAAGCCTCTCAAGGCGATGGAAGAACACCTTTTGAAGAAGAATGTCGCCCGTGAAGCTGCTGTCCGGCTC
TGCGAGGGAGTTAAGCTTGAGATGATTGGCAAGAAGACTGGCAATTTCCAGAGTACTGATGCCGCATTGCATGTG
GCCATGGAATCCTCGCTGCGGAAGATCCTGACACCGACCTCTTCTTTGGATTTGCTGCGCGAGATTAACGCTGTG
GTCGCTCCCACCACCAAGCAGCAGGCGCCTCGTCCATATGTCATGTCTATTGTTGGCGTCAACGGCGTTGGAAAG
TCGACCAACCTGAGCAAGATCTGCTACTTCTTGCTTCAAAACAAGTACCGTGTTCTTATTGCCGCTTGCGATACT
TTCCGTTCCGGTGCCGTGGAGCAGCTCCGCGTGCACGCTGACCGCTTGAAGGAACTGAGCGTTCGTGAAAATGCA
GGCGATGTGGAGATCTACCAGAAGGGCTACGGCAAGGACGCAGCCAACGTTGCCAAGGATGCAGTCGAATACGCT
GCGGCCAATAAGTTTGATGTCGTCCTGATCGACACTGCCGGTCGTCGGCATAACGACCAGCGGCTGATGTCGTCG
CTTGAGAAGTTCGCCAAGTTCGCTAACCCAGACAAGATTTTCATGGTTGGTGAGGCTCTGGTCGGCACGGACAGT
GTCATGCAGGCTCGCAACTTCAACCAGGCATTTGGCACCGGTAGGAACTTGGACGGTTTCATTATCAGTAAATGT
GACACTGTCGGCGACATGGTGGGAACACTGGTCAGCATGGTCCATGCCACGGGAATTCCCATTGTGTTCCTGGGC
GTTGGACAACATTATGGAGATCTGCGAGGGCTCAGTGTTCCCTGGGCTGTTAGTCTGCTGATGAAGTAG
Transcript >Pro_DTO070G2_2|g4454.t1
ATGTTGGAGGCTTTTGAAATTTTAACCACATCGGGCGTGGTGCTTTGGTCTAAGGCCTACGCTCCGGTGGGCGCA
CATGTTATCAACAGCCTGATCAACGATGTCTTTATCGAGGAGAAGGTCGTGCCGCAGAATGCTACAACTAATGGG
ATCTCGCCGGCATACAAGAAGGAGAAATATACACTGAAATGGAAGAGAGTCAAGGAATTCGATTTGATCTTCGTG
GCCGTCTACCAATCGCTACTCCACCTTGGCTGGATAGACAAACTTCTTGAGAACATTTCAACCATCTTTATTGAT
CTCTACAAGGACCAGGTGAAGGGAAACCGCGCGAGAATCCAGACCTATCGGTTCGATCAATACTTTGAACAGCAA
GTTCGGGAGCTTGAAGACAACGCTGGTGGATTCGTAGAAGAACATGTGCCAGAGACGGGTGAAAAGAAAGACCCG
CTTGTTTCGTCGGACAATGGAGGCCCACCGCCGCCACCGGTGCCTGGCCTGGTGAAAGCGCAGCCCAGAGCTGCG
CTAGCCGGGGCGACCTCTGATGAGGGTACGCCACCAGCTACACCAGAAATTTCTAGATCTTCGACCCCTCAGGGT
CATCTTCTTACAGCCAAAGCCGGGCCTGGAGGTCGTGGCTCTCGACGTTCCCGCAAGGCTGCCAATTCGAACGCC
AACGCATCGTCTGGTGATGAAGCCCGGAAGGGAAAGCCTGTCAAGTCCCCTGTGAAGAAGATGCGCAGATGGGAT
GCTAGTGGGATGGCAGATGAGGATGACGGAGAAATCCTCGATTATTCTGCCCCCGCGGAGGAAGGAGAGACCGTC
GCCCCTGCGGTGGAGGCTGTCTCCGAGGAGGATTGGGGTCGTCGAACCGGCAAGGGCCAATTCGTGCTGAAAGAG
TTGGGCGAGGAAGTTCAATCCATCTTGGACCAAGCTGATGCTGAAAAGTCCAAAGGTACTGCTTCGTCTGGTGTG
GTTGGCTCCGGGTTCAACGCAATTGGTGGCTTCTTCCGTAACATCGTCGGAGGAAAGGTTCTGACAGAATCTGAT
CTCGAGAAGCCTCTCAAGGCGATGGAAGAACACCTTTTGAAGAAGAATGTCGCCCGTGAAGCTGCTGTCCGGCTC
TGCGAGGGAGTTAAGCTTGAGATGATTGGCAAGAAGACTGGCAATTTCCAGAGTACTGATGCCGCATTGCATGTG
GCCATGGAATCCTCGCTGCGGAAGATCCTGACACCGACCTCTTCTTTGGATTTGCTGCGCGAGATTAACGCTGTG
GTCGCTCCCACCACCAAGCAGCAGGCGCCTCGTCCATATGTCATGTCTATTGTTGGCGTCAACGGCGTTGGAAAG
TCGACCAACCTGAGCAAGATCTGCTACTTCTTGCTTCAAAACAAGTACCGTGTTCTTATTGCCGCTTGCGATACT
TTCCGTTCCGGTGCCGTGGAGCAGCTCCGCGTGCACGCTGACCGCTTGAAGGAACTGAGCGTTCGTGAAAATGCA
GGCGATGTGGAGATCTACCAGAAGGGCTACGGCAAGGACGCAGCCAACGTTGCCAAGGATGCAGTCGAATACGCT
GCGGCCAATAAGTTTGATGTCGTCCTGATCGACACTGCCGGTCGTCGGCATAACGACCAGCGGCTGATGTCGTCG
CTTGAGAAGTTCGCCAAGTTCGCTAACCCAGACAAGATTTTCATGGTTGGTGAGGCTCTGGTCGGCACGGACAGT
GTCATGCAGGCTCGCAACTTCAACCAGGCATTTGGCACCGGTAGGAACTTGGACGGTTTCATTATCAGTAAATGT
GACACTGTCGGCGACATGGTGGGAACACTGGTCAGCATGGTCCATGCCACGGGAATTCCCATTGTGTTCCTGGGC
GTTGGACAACATTATGGAGATCTGCGAGGGCTCAGTGTTCCCTGGGCTGTTAGTCTGCTGATGAAGTAG
Gene >Pro_DTO070G2_2|g4454.t1
ATGTTGGAGGCTTTTGAAATTTTAACCACATCGGGCGTGGTGCTTTGGTCTAAGGCCTACGCTCCGGTGGGCGCA
CATGTTATCAACAGCCTGATCAACGATGTCTTTATCGAGGAGAAGGTCGTGCCGCAGAATGCTACAACTAATGGG
ATCTCGCCGGCATACAAGAAGGAGAAATATACACTGAAATGGAAGAGAGTCAAGGAATTCGATTTGATCTTCGTG
GTATGTCTGTCGCATGCACATGCGCTCGCTGCTTCGACTAACTCTGGGTTTATGCAGGCCGTCTACCAATCGCTA
CTCCACCTTGGCTGGATAGACAAACTTCTTGAGAACATTTCAACCATCTTTATTGATCTCTACAAGGACCAGGTG
AAGGGAAACCGCGCGAGAATCCAGACCTATCGGTTCGATCAATACTTTGAACAGCAAGTTCGGGAGCTTGAAGAC
AACGCTGGTGGATTCGTAGAAGAACATGTGCCAGAGACGGGTGAAAAGAAAGACCCGCTTGTTTCGTCGGACAAT
GGAGGCCCACCGCCGCCACCGGTGCCTGGCCTGGTGAAAGGTATGGAATGACAAACCCCAGTTTTAGTTTCAAGC
GCATGCTGACCATCCTAAAGCGCAGCCCAGAGCTGCGCTAGCCGGGGCGACCTCTGATGAGGGTACGCCACCAGC
TACACCAGAAATTTCTAGATCTTCGACCCCTCAGGGTCATCTTCTTACAGCCAAAGCCGGGCCTGGAGGTCGTGG
CTCTCGACGTTCCCGCAAGGCTGCCAATTCGAACGCCAACGCATCGTCTGGTGATGAAGCCCGGAAGGGAAAGCC
TGTCAAGTCCCCTGTGAAGAAGATGCGCAGATGGGATGCTAGTGGGATGGCAGATGAGGATGACGGAGAAATCCT
CGATTATTCTGCCCCCGCGGAGGAAGGAGAGACCGTCGCCCCTGCGGTGGAGGCTGTCTCCGAGGAGGATTGGGG
TCGTCGAACCGGCAAGGGCCAATTCGTGCTGAAAGAGTTGGGCGAGGAAGTTCAATCCATCTTGGACCAAGCTGA
TGCTGAAAAGTCCAAAGGTACTGCTTCGTCTGGTGTGGTTGGCTCCGGGTTCAACGCAATTGGTGGCTTCTTCCG
TAACATCGTCGGAGGAAAGGTTCTGACAGAATCTGATCTCGAGAAGCCTCTCAAGGCGATGGAAGAACACCTTTT
GAAGAAGAATGTCGCCCGTGAAGCTGCTGTCCGGCTCTGCGAGGGAGTTAAGCTTGAGATGATTGGCAAGAAGAC
TGGCAATTTCCAGAGTACTGATGCCGCATTGCATGTGGCCATGGAATCCTCGCTGCGGAAGATCCTGACACCGAC
CTCTTCTTTGGATTTGCTGCGCGAGATTAACGCTGTGGTCGCTCCCACCACCAAGCAGCAGGCGCCTCGTCCATA
TGTCATGTCTATTGTTGGCGTCAACGGCGTTGGAAAGTCGACCAACCTGAGCAAGATCTGCTACTTCTTGCTTCA
AAACAAGTACCGTGTTCTTATTGCCGCTTGCGATACTTTCCGTTCCGGTGCCGTGGAGCAGCTCCGCGTGCACGC
TGACCGCTTGAAGGAACTGAGCGTTCGTGAAAATGCAGGCGATGTGGAGATCTACCAGAAGGGCTACGGCAAGGA
CGCAGCCAACGTTGCCAAGGATGCAGTCGAATACGCTGCGGCCAATAAGTTTGATGTCGTCCTGATCGACACTGC
CGGTCGTCGGCATAACGACCAGCGGCTGATGTCGTCGCTTGAGAAGTTCGCCAAGTTCGCTAACCCAGACAAGAT
TTTCATGGTTGGTGAGGCTCTGGTCGGCACGGACAGTGTCATGCAGGCTCGCAACTTCAACCAGGCATTTGGCAC
CGGTAGGAACTTGGACGGTTTCATTATCAGTAAATGTGACACTGTCGGCGACATGGTGGGAACACTGGTCAGCAT
GGTCCATGCCACGGGAATTCCCATTGTGTTCCTGGGCGTTGGACAACATTATGGAGATCTGCGAGGGCTCAGTGT
TCCCTGGGCTGTTAGTCTGCTGATGAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail