Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g4335.t1
Gene name
Locationscaffold_04:1404035..1405328
Strand+
Gene length (bp)1293
Transcript length (bp)1293
Coding sequence length (bp)1293
Protein length (aa) 431

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 4.5E-30 227 429
PF00668 Condensation Condensation domain 3.5E-09 14 208

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g4335.t1
MIGQKNAETSVYGDVSLLSQAKEFAHEHQVSVKVVLLAGWAVNFSRHLQSDDVAFYTNLRDCSFDTEYIVGPMDV
TAPLRIQPLENESTLEALYRLESEKRTVSQSSYVGGSAIREYSQSQASLTSMFTVRESEIPMHKVEALDVTTETT
LNWPTGQLSLVHDSSYSSARAKIILQHFWEVLQQIISSPYDRFKSLSLTSEQEKSSLLSFRSSRGNVSPQVGHNL
IEKQTRDNGDAPALQFQLSEFMSFAKLNAAANRVAHRLTGLMSTGTIVPVHMDVSVQFVIVLLAILKAGGAYVIL
DHFQPPSRKAYILNDVKAPFYMKNGGPIKGIADVLAYSITDLMHGSTPDAEIDLGLSLDPEQPAYIIYTSGSTGV
LKGVVLSHRAASTGILCAPDISNNRSLLFYNPIFSAAQRTILSTLAKGGCLCLAS*
Coding >Pro_DTO070G2_2|g4335.t1
ATGATTGGACAGAAGAACGCTGAAACGAGTGTATACGGCGATGTTAGCCTTCTCTCTCAAGCAAAGGAGTTTGCA
CACGAGCATCAAGTTAGCGTCAAAGTGGTGCTCCTTGCCGGCTGGGCTGTCAACTTTTCCCGCCATCTGCAGAGC
GATGATGTGGCCTTTTATACCAACCTTCGGGATTGCAGCTTTGACACAGAATATATCGTTGGTCCTATGGACGTG
ACCGCTCCTCTTCGAATTCAACCTTTGGAGAACGAGTCCACACTCGAAGCTCTCTATAGATTGGAAAGCGAAAAG
AGAACTGTTTCTCAATCTTCCTATGTGGGAGGAAGCGCCATCAGGGAGTACAGCCAAAGCCAAGCCTCCCTGACG
TCCATGTTCACTGTTCGTGAATCAGAGATCCCCATGCACAAAGTTGAGGCCCTCGATGTTACCACAGAAACAACA
CTCAACTGGCCAACTGGCCAACTCTCCCTGGTCCATGACTCGAGTTACTCATCGGCCCGAGCCAAGATCATTTTG
CAGCACTTCTGGGAAGTCCTCCAGCAGATCATCTCGAGTCCATACGACCGATTCAAGAGTTTGAGTCTCACGTCC
GAGCAAGAGAAAAGCTCCCTGTTGAGCTTCAGGTCTTCCCGTGGAAACGTCTCCCCTCAGGTGGGGCATAACCTG
ATTGAGAAACAAACTCGTGATAATGGAGATGCTCCAGCTCTACAGTTTCAACTTAGCGAATTCATGAGCTTTGCT
AAGCTGAATGCTGCTGCGAACCGTGTCGCTCATCGTCTCACTGGGTTGATGTCGACAGGGACCATCGTTCCGGTT
CACATGGATGTATCCGTCCAGTTCGTGATTGTTCTCCTGGCTATTCTGAAGGCGGGAGGTGCCTATGTGATTCTT
GATCACTTCCAGCCACCATCTCGCAAAGCATACATTCTCAACGATGTCAAAGCACCATTCTACATGAAAAATGGG
GGCCCTATCAAAGGGATTGCAGATGTGCTGGCTTACTCAATTACGGATCTCATGCATGGTTCCACCCCCGATGCG
GAAATCGATTTGGGCTTATCTCTGGACCCTGAGCAGCCTGCATATATCATTTATACCTCGGGGTCTACCGGTGTT
CTCAAGGGCGTGGTCTTGAGTCACCGCGCGGCTTCCACTGGGATCCTCTGTGCTCCAGATATATCCAACAACCGC
AGCCTGCTTTTCTACAATCCCATCTTCTCAGCAGCCCAGAGAACCATTCTGTCTACTCTAGCCAAGGGTGGCTGT
CTCTGCCTGGCAAGTTGA
Transcript >Pro_DTO070G2_2|g4335.t1
ATGATTGGACAGAAGAACGCTGAAACGAGTGTATACGGCGATGTTAGCCTTCTCTCTCAAGCAAAGGAGTTTGCA
CACGAGCATCAAGTTAGCGTCAAAGTGGTGCTCCTTGCCGGCTGGGCTGTCAACTTTTCCCGCCATCTGCAGAGC
GATGATGTGGCCTTTTATACCAACCTTCGGGATTGCAGCTTTGACACAGAATATATCGTTGGTCCTATGGACGTG
ACCGCTCCTCTTCGAATTCAACCTTTGGAGAACGAGTCCACACTCGAAGCTCTCTATAGATTGGAAAGCGAAAAG
AGAACTGTTTCTCAATCTTCCTATGTGGGAGGAAGCGCCATCAGGGAGTACAGCCAAAGCCAAGCCTCCCTGACG
TCCATGTTCACTGTTCGTGAATCAGAGATCCCCATGCACAAAGTTGAGGCCCTCGATGTTACCACAGAAACAACA
CTCAACTGGCCAACTGGCCAACTCTCCCTGGTCCATGACTCGAGTTACTCATCGGCCCGAGCCAAGATCATTTTG
CAGCACTTCTGGGAAGTCCTCCAGCAGATCATCTCGAGTCCATACGACCGATTCAAGAGTTTGAGTCTCACGTCC
GAGCAAGAGAAAAGCTCCCTGTTGAGCTTCAGGTCTTCCCGTGGAAACGTCTCCCCTCAGGTGGGGCATAACCTG
ATTGAGAAACAAACTCGTGATAATGGAGATGCTCCAGCTCTACAGTTTCAACTTAGCGAATTCATGAGCTTTGCT
AAGCTGAATGCTGCTGCGAACCGTGTCGCTCATCGTCTCACTGGGTTGATGTCGACAGGGACCATCGTTCCGGTT
CACATGGATGTATCCGTCCAGTTCGTGATTGTTCTCCTGGCTATTCTGAAGGCGGGAGGTGCCTATGTGATTCTT
GATCACTTCCAGCCACCATCTCGCAAAGCATACATTCTCAACGATGTCAAAGCACCATTCTACATGAAAAATGGG
GGCCCTATCAAAGGGATTGCAGATGTGCTGGCTTACTCAATTACGGATCTCATGCATGGTTCCACCCCCGATGCG
GAAATCGATTTGGGCTTATCTCTGGACCCTGAGCAGCCTGCATATATCATTTATACCTCGGGGTCTACCGGTGTT
CTCAAGGGCGTGGTCTTGAGTCACCGCGCGGCTTCCACTGGGATCCTCTGTGCTCCAGATATATCCAACAACCGC
AGCCTGCTTTTCTACAATCCCATCTTCTCAGCAGCCCAGAGAACCATTCTGTCTACTCTAGCCAAGGGTGGCTGT
CTCTGCCTGGCAAGTTGA
Gene >Pro_DTO070G2_2|g4335.t1
ATGATTGGACAGAAGAACGCTGAAACGAGTGTATACGGCGATGTTAGCCTTCTCTCTCAAGCAAAGGAGTTTGCA
CACGAGCATCAAGTTAGCGTCAAAGTGGTGCTCCTTGCCGGCTGGGCTGTCAACTTTTCCCGCCATCTGCAGAGC
GATGATGTGGCCTTTTATACCAACCTTCGGGATTGCAGCTTTGACACAGAATATATCGTTGGTCCTATGGACGTG
ACCGCTCCTCTTCGAATTCAACCTTTGGAGAACGAGTCCACACTCGAAGCTCTCTATAGATTGGAAAGCGAAAAG
AGAACTGTTTCTCAATCTTCCTATGTGGGAGGAAGCGCCATCAGGGAGTACAGCCAAAGCCAAGCCTCCCTGACG
TCCATGTTCACTGTTCGTGAATCAGAGATCCCCATGCACAAAGTTGAGGCCCTCGATGTTACCACAGAAACAACA
CTCAACTGGCCAACTGGCCAACTCTCCCTGGTCCATGACTCGAGTTACTCATCGGCCCGAGCCAAGATCATTTTG
CAGCACTTCTGGGAAGTCCTCCAGCAGATCATCTCGAGTCCATACGACCGATTCAAGAGTTTGAGTCTCACGTCC
GAGCAAGAGAAAAGCTCCCTGTTGAGCTTCAGGTCTTCCCGTGGAAACGTCTCCCCTCAGGTGGGGCATAACCTG
ATTGAGAAACAAACTCGTGATAATGGAGATGCTCCAGCTCTACAGTTTCAACTTAGCGAATTCATGAGCTTTGCT
AAGCTGAATGCTGCTGCGAACCGTGTCGCTCATCGTCTCACTGGGTTGATGTCGACAGGGACCATCGTTCCGGTT
CACATGGATGTATCCGTCCAGTTCGTGATTGTTCTCCTGGCTATTCTGAAGGCGGGAGGTGCCTATGTGATTCTT
GATCACTTCCAGCCACCATCTCGCAAAGCATACATTCTCAACGATGTCAAAGCACCATTCTACATGAAAAATGGG
GGCCCTATCAAAGGGATTGCAGATGTGCTGGCTTACTCAATTACGGATCTCATGCATGGTTCCACCCCCGATGCG
GAAATCGATTTGGGCTTATCTCTGGACCCTGAGCAGCCTGCATATATCATTTATACCTCGGGGTCTACCGGTGTT
CTCAAGGGCGTGGTCTTGAGTCACCGCGCGGCTTCCACTGGGATCCTCTGTGCTCCAGATATATCCAACAACCGC
AGCCTGCTTTTCTACAATCCCATCTTCTCAGCAGCCCAGAGAACCATTCTGTCTACTCTAGCCAAGGGTGGCTGT
CTCTGCCTGGCAAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail