Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g4254.t1
Gene name
Locationscaffold_04:1189625..1193587
Strand-
Gene length (bp)3962
Transcript length (bp)3828
Coding sequence length (bp)3828
Protein length (aa) 1276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16414 NPC1_N Niemann-Pick C1 N terminus 7.1E-86 32 268
PF02460 Patched Patched family 6.0E-50 510 880
PF02460 Patched Patched family 6.3E-26 986 1238
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 9.9E-52 635 788
PF03176 MMPL MMPL family 6.2E-05 561 775

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 269 291 22
2 355 377 22
3 600 622 22
4 643 665 22
5 669 691 22
6 717 739 22
7 749 771 22
8 1070 1092 22
9 1102 1124 22
10 1131 1153 22
11 1181 1203 22
12 1216 1238 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g4254.t1
MRLPRALALIVGLGSFAPTLVGAQGETKIHEKGRCAIRGHCGKQSIFGGELPCPDNDLAQQPEDAVRQKLVNLCG
SKWSEGPVCCRDEQIDALSSNLKLAEGIIASCPACRDNFFNIFCTFTCSPDQSLFINVTKTEENRSGKRLVTELD
NIWSEEYQNGFYDSCKNVKNGASGGKAIDFIGGGAKDAPHFMKFLGDKKFLGSPFQINYHTEPTGPDPQGMKALS
IKPKACNDEDKSFRCSCVDCPEVCPELPAISPHKICHVGLLPCLSFAVILVYSVFLLFVIALASYVTYKERRFRK
PERVRLLQDPTPSDDEDEGEVMHRGGYMERSHGVYKLNSVLSAMFHRIGGACARFPAIAIFSSVIGVVLLSLGWL
NFTVETDPVQLWVSPSSAAAQEKDFFDQSFGPFFRAEQAFLVNNRPGNDSRPLLDYETLTWWFDVESRVRRVISL
DQALNFDDVCFKPTGEACVVQSFTGYFGGSVSNLDPDTWKDRLSHCTKSPGDPSCLPDFSQPLKPEMILGGYDDT
GNVLDAQALIVTWVVNNYDQGTEEEAKAIDWENTFQAVLGVVQEEAAERGLRVSFNSEVSLEQELNKSTNTDAKI
VVISYLIMFFYVSMALGSVTVTWRSLLTNPSNALVQSKFTLGIVGIIIVLMSVSASVGLFSAAGVKVTLIIAEVI
PFLVLAVGVDNIFLIVHEFERVNISHPDEEIDERVARAVGRIGPSIFLSALTETVAFALGIFVGMPAVKNFAAYA
AGAVFINAILQITMFISVLALNQRRVQSLRADCIPCLTVRKANSFGFPGENYDGQEAESTLQVFIRRVYAPFLLD
RRVKVGVVIFFLGLLTAGLAFIPEVPLGLDQRIALPSDSYLISYFNDLDSYFDTGPPVYFVTRNVNVTERSHQQQ
LCGRFTTCEEYSLPFILEQESKRPNVSYLAGSAASWIDDFFYWLNPQQDCCKENGKLCFEDRVPAWNISLSGMPE
GSEFVHYAQKWIDAPTDASCPLGGKAPYSNALVIDDKYKTINASHFRTSHTPLRSQNEFIEAYIAARRIADDISR
EHDIDVFPYSKFYIFFDQYVSIVRLTGTLLGSAVAIIFVLTSVILGSIATGAVITTTVVMIVVDIIGTMAIAGVS
LNAVSLVNLVICVGIGVEFCAHIARAFMFPARPIMDKVPAEFRGKDARAWAALVNVGGTVFSGITVTKLLGVCVL
AFTRSKIFEIYYFRVWLALVIFAATHALIFLPVALSYFGGGGYFDPASEGGLEANLASRGYRSSLLHDEYESDEY
*
Coding >Pro_DTO070G2_2|g4254.t1
ATGCGGTTGCCTAGGGCTCTCGCCCTGATCGTTGGGCTGGGCTCTTTTGCACCTACCCTTGTCGGTGCACAGGGC
GAAACTAAAATCCACGAAAAGGGCCGTTGTGCTATTCGAGGTCATTGTGGAAAGCAATCCATTTTTGGAGGTGAA
CTACCCTGTCCAGATAATGACCTGGCGCAACAACCAGAAGACGCAGTACGCCAAAAGTTGGTAAATCTGTGTGGC
AGCAAATGGAGCGAAGGGCCGGTCTGTTGTCGAGATGAACAGATCGATGCGCTTTCCAGTAACCTCAAACTAGCA
GAGGGAATTATCGCGTCCTGCCCTGCCTGCCGAGACAACTTCTTCAACATATTCTGTACCTTTACATGCTCCCCC
GATCAATCCCTTTTCATCAATGTCACCAAAACAGAAGAAAACAGATCTGGTAAAAGACTTGTGACCGAGTTGGAC
AATATTTGGTCCGAGGAGTACCAGAACGGCTTCTACGATAGCTGCAAGAACGTAAAGAACGGTGCCTCGGGCGGG
AAAGCCATTGACTTCATCGGCGGTGGTGCGAAAGACGCTCCCCATTTCATGAAGTTTTTAGGTGATAAGAAGTTT
CTCGGGAGCCCGTTCCAGATTAACTATCACACAGAGCCCACTGGGCCTGACCCGCAAGGAATGAAGGCTTTGTCA
ATAAAGCCGAAAGCCTGCAATGACGAGGACAAATCATTCCGATGTTCTTGTGTCGACTGCCCGGAAGTGTGTCCG
GAGTTGCCTGCCATCTCCCCCCACAAGATATGTCATGTAGGACTTCTACCATGTCTATCGTTTGCCGTCATTCTC
GTTTATTCCGTCTTTCTATTATTTGTCATTGCTCTCGCGAGCTATGTCACATACAAGGAACGCCGTTTCCGCAAA
CCAGAGCGGGTGCGGTTGCTACAAGATCCCACGCCCAGCGATGACGAAGATGAAGGGGAAGTCATGCACCGTGGA
GGATATATGGAAAGATCACATGGAGTATACAAGCTCAACTCTGTGTTGTCAGCTATGTTTCATCGAATCGGTGGT
GCTTGTGCGCGGTTCCCAGCAATAGCAATATTCTCCAGCGTCATCGGAGTGGTGCTGCTGAGCCTAGGGTGGCTA
AATTTCACCGTTGAAACGGATCCGGTGCAACTCTGGGTGAGTCCGTCATCTGCAGCCGCCCAGGAGAAGGATTTC
TTCGATCAGAGCTTTGGTCCATTCTTCCGAGCCGAGCAGGCATTTTTGGTGAATAACCGCCCAGGTAATGACTCA
CGTCCGCTCTTGGACTACGAAACCCTTACTTGGTGGTTTGACGTCGAATCTCGTGTGCGACGCGTGATCTCGTTG
GACCAGGCTCTCAATTTCGATGACGTTTGTTTCAAGCCGACTGGAGAAGCTTGTGTCGTGCAATCCTTCACTGGG
TATTTCGGCGGTTCCGTCTCAAACCTTGACCCAGATACATGGAAGGACAGACTTAGCCACTGCACAAAGTCGCCT
GGCGACCCTAGCTGTCTCCCCGATTTCTCGCAGCCCCTCAAGCCCGAAATGATTCTTGGTGGATATGATGACACA
GGGAATGTTCTGGATGCCCAGGCACTCATTGTGACCTGGGTGGTAAATAATTACGACCAGGGAACAGAAGAAGAA
GCAAAAGCCATTGACTGGGAGAACACTTTCCAGGCCGTTCTCGGGGTAGTCCAAGAAGAGGCTGCCGAGCGAGGC
CTTCGCGTATCTTTTAATTCCGAGGTCAGCTTGGAACAGGAACTGAACAAGTCTACCAACACAGATGCGAAGATT
GTTGTCATCAGTTACCTGATCATGTTCTTCTACGTCTCAATGGCCCTGGGCTCGGTCACAGTTACCTGGAGGTCT
CTGCTGACCAATCCATCCAATGCTCTTGTTCAGTCTAAATTTACACTGGGGATCGTCGGGATCATCATTGTCCTG
ATGTCTGTTTCTGCATCGGTCGGACTGTTCTCGGCAGCGGGCGTCAAGGTGACCTTGATCATTGCTGAAGTAATT
CCATTCTTGGTCCTGGCAGTCGGAGTAGACAACATTTTCTTGATCGTCCACGAATTCGAGCGAGTCAATATCAGC
CATCCCGATGAAGAAATCGACGAGCGAGTTGCCCGAGCTGTTGGTCGAATCGGACCTAGCATCTTCCTGTCTGCT
CTGACGGAGACAGTAGCCTTTGCCCTGGGCATCTTTGTTGGTATGCCCGCTGTCAAGAATTTTGCCGCATACGCC
GCTGGTGCTGTCTTCATTAACGCCATCCTGCAAATCACCATGTTCATCTCCGTCTTGGCTCTGAACCAGAGACGG
GTGCAGAGTCTCCGTGCGGACTGTATCCCTTGTCTTACTGTACGCAAAGCAAATTCGTTCGGCTTCCCTGGGGAG
AACTACGATGGCCAGGAAGCAGAGAGCACTTTGCAGGTCTTCATTCGTCGGGTCTATGCGCCTTTCCTCCTGGAT
CGTCGGGTGAAAGTTGGCGTTGTTATATTTTTCTTGGGTCTTTTGACTGCCGGTCTAGCCTTCATCCCCGAGGTT
CCTCTTGGGTTAGATCAGCGTATCGCGCTCCCTAGCGACTCGTATCTGATTTCGTATTTCAACGACCTAGATTCA
TACTTTGACACAGGGCCTCCGGTCTATTTCGTGACTCGGAATGTGAATGTTACCGAACGAAGTCACCAACAACAG
CTCTGTGGACGATTCACCACTTGCGAGGAGTATTCACTTCCCTTTATTCTTGAGCAAGAGTCTAAGCGTCCGAAT
GTTTCTTATCTTGCAGGCTCTGCCGCCAGCTGGATTGATGATTTCTTCTATTGGCTGAACCCCCAGCAAGACTGT
TGCAAAGAAAACGGCAAGCTTTGTTTCGAGGACCGCGTTCCTGCCTGGAACATCTCTCTTTCGGGAATGCCGGAA
GGATCTGAATTTGTCCATTACGCCCAAAAATGGATCGATGCTCCCACCGATGCATCCTGCCCCCTCGGTGGTAAA
GCGCCCTACAGCAATGCTTTGGTCATTGATGACAAGTATAAAACGATCAACGCCAGTCATTTCCGTACTAGCCAC
ACGCCTCTTCGGAGCCAGAATGAATTTATCGAGGCATATATTGCAGCTCGCCGGATTGCAGATGACATCTCACGG
GAACATGATATCGACGTCTTCCCATATTCCAAATTCTACATCTTCTTTGATCAATACGTTTCCATTGTGCGACTT
ACTGGTACCCTGCTTGGGTCGGCCGTGGCCATCATCTTCGTCTTGACCTCTGTGATATTGGGGTCTATAGCCACG
GGCGCTGTCATTACAACCACAGTGGTTATGATAGTGGTCGATATCATTGGCACTATGGCGATCGCTGGCGTCTCC
TTGAATGCGGTATCTCTTGTCAACTTGGTCATTTGTGTCGGCATTGGTGTTGAGTTCTGTGCTCATATTGCCCGA
GCATTCATGTTCCCCGCTCGACCCATCATGGATAAGGTGCCCGCCGAATTCCGTGGTAAGGACGCTCGAGCATGG
GCGGCCTTGGTCAATGTTGGTGGGACTGTCTTCAGTGGTATTACCGTGACAAAACTTCTCGGAGTTTGCGTCCTG
GCATTTACTCGAAGCAAGATCTTCGAGATCTACTACTTCCGGGTTTGGCTAGCCCTGGTGATTTTTGCTGCTACG
CATGCTCTCATCTTCTTACCAGTGGCTCTCAGCTACTTTGGCGGCGGTGGCTACTTTGACCCTGCCTCCGAAGGT
GGCCTAGAGGCCAATCTCGCTTCACGTGGCTACCGCTCATCGCTACTCCATGATGAATATGAGTCTGATGAATAT
TAA
Transcript >Pro_DTO070G2_2|g4254.t1
ATGCGGTTGCCTAGGGCTCTCGCCCTGATCGTTGGGCTGGGCTCTTTTGCACCTACCCTTGTCGGTGCACAGGGC
GAAACTAAAATCCACGAAAAGGGCCGTTGTGCTATTCGAGGTCATTGTGGAAAGCAATCCATTTTTGGAGGTGAA
CTACCCTGTCCAGATAATGACCTGGCGCAACAACCAGAAGACGCAGTACGCCAAAAGTTGGTAAATCTGTGTGGC
AGCAAATGGAGCGAAGGGCCGGTCTGTTGTCGAGATGAACAGATCGATGCGCTTTCCAGTAACCTCAAACTAGCA
GAGGGAATTATCGCGTCCTGCCCTGCCTGCCGAGACAACTTCTTCAACATATTCTGTACCTTTACATGCTCCCCC
GATCAATCCCTTTTCATCAATGTCACCAAAACAGAAGAAAACAGATCTGGTAAAAGACTTGTGACCGAGTTGGAC
AATATTTGGTCCGAGGAGTACCAGAACGGCTTCTACGATAGCTGCAAGAACGTAAAGAACGGTGCCTCGGGCGGG
AAAGCCATTGACTTCATCGGCGGTGGTGCGAAAGACGCTCCCCATTTCATGAAGTTTTTAGGTGATAAGAAGTTT
CTCGGGAGCCCGTTCCAGATTAACTATCACACAGAGCCCACTGGGCCTGACCCGCAAGGAATGAAGGCTTTGTCA
ATAAAGCCGAAAGCCTGCAATGACGAGGACAAATCATTCCGATGTTCTTGTGTCGACTGCCCGGAAGTGTGTCCG
GAGTTGCCTGCCATCTCCCCCCACAAGATATGTCATGTAGGACTTCTACCATGTCTATCGTTTGCCGTCATTCTC
GTTTATTCCGTCTTTCTATTATTTGTCATTGCTCTCGCGAGCTATGTCACATACAAGGAACGCCGTTTCCGCAAA
CCAGAGCGGGTGCGGTTGCTACAAGATCCCACGCCCAGCGATGACGAAGATGAAGGGGAAGTCATGCACCGTGGA
GGATATATGGAAAGATCACATGGAGTATACAAGCTCAACTCTGTGTTGTCAGCTATGTTTCATCGAATCGGTGGT
GCTTGTGCGCGGTTCCCAGCAATAGCAATATTCTCCAGCGTCATCGGAGTGGTGCTGCTGAGCCTAGGGTGGCTA
AATTTCACCGTTGAAACGGATCCGGTGCAACTCTGGGTGAGTCCGTCATCTGCAGCCGCCCAGGAGAAGGATTTC
TTCGATCAGAGCTTTGGTCCATTCTTCCGAGCCGAGCAGGCATTTTTGGTGAATAACCGCCCAGGTAATGACTCA
CGTCCGCTCTTGGACTACGAAACCCTTACTTGGTGGTTTGACGTCGAATCTCGTGTGCGACGCGTGATCTCGTTG
GACCAGGCTCTCAATTTCGATGACGTTTGTTTCAAGCCGACTGGAGAAGCTTGTGTCGTGCAATCCTTCACTGGG
TATTTCGGCGGTTCCGTCTCAAACCTTGACCCAGATACATGGAAGGACAGACTTAGCCACTGCACAAAGTCGCCT
GGCGACCCTAGCTGTCTCCCCGATTTCTCGCAGCCCCTCAAGCCCGAAATGATTCTTGGTGGATATGATGACACA
GGGAATGTTCTGGATGCCCAGGCACTCATTGTGACCTGGGTGGTAAATAATTACGACCAGGGAACAGAAGAAGAA
GCAAAAGCCATTGACTGGGAGAACACTTTCCAGGCCGTTCTCGGGGTAGTCCAAGAAGAGGCTGCCGAGCGAGGC
CTTCGCGTATCTTTTAATTCCGAGGTCAGCTTGGAACAGGAACTGAACAAGTCTACCAACACAGATGCGAAGATT
GTTGTCATCAGTTACCTGATCATGTTCTTCTACGTCTCAATGGCCCTGGGCTCGGTCACAGTTACCTGGAGGTCT
CTGCTGACCAATCCATCCAATGCTCTTGTTCAGTCTAAATTTACACTGGGGATCGTCGGGATCATCATTGTCCTG
ATGTCTGTTTCTGCATCGGTCGGACTGTTCTCGGCAGCGGGCGTCAAGGTGACCTTGATCATTGCTGAAGTAATT
CCATTCTTGGTCCTGGCAGTCGGAGTAGACAACATTTTCTTGATCGTCCACGAATTCGAGCGAGTCAATATCAGC
CATCCCGATGAAGAAATCGACGAGCGAGTTGCCCGAGCTGTTGGTCGAATCGGACCTAGCATCTTCCTGTCTGCT
CTGACGGAGACAGTAGCCTTTGCCCTGGGCATCTTTGTTGGTATGCCCGCTGTCAAGAATTTTGCCGCATACGCC
GCTGGTGCTGTCTTCATTAACGCCATCCTGCAAATCACCATGTTCATCTCCGTCTTGGCTCTGAACCAGAGACGG
GTGCAGAGTCTCCGTGCGGACTGTATCCCTTGTCTTACTGTACGCAAAGCAAATTCGTTCGGCTTCCCTGGGGAG
AACTACGATGGCCAGGAAGCAGAGAGCACTTTGCAGGTCTTCATTCGTCGGGTCTATGCGCCTTTCCTCCTGGAT
CGTCGGGTGAAAGTTGGCGTTGTTATATTTTTCTTGGGTCTTTTGACTGCCGGTCTAGCCTTCATCCCCGAGGTT
CCTCTTGGGTTAGATCAGCGTATCGCGCTCCCTAGCGACTCGTATCTGATTTCGTATTTCAACGACCTAGATTCA
TACTTTGACACAGGGCCTCCGGTCTATTTCGTGACTCGGAATGTGAATGTTACCGAACGAAGTCACCAACAACAG
CTCTGTGGACGATTCACCACTTGCGAGGAGTATTCACTTCCCTTTATTCTTGAGCAAGAGTCTAAGCGTCCGAAT
GTTTCTTATCTTGCAGGCTCTGCCGCCAGCTGGATTGATGATTTCTTCTATTGGCTGAACCCCCAGCAAGACTGT
TGCAAAGAAAACGGCAAGCTTTGTTTCGAGGACCGCGTTCCTGCCTGGAACATCTCTCTTTCGGGAATGCCGGAA
GGATCTGAATTTGTCCATTACGCCCAAAAATGGATCGATGCTCCCACCGATGCATCCTGCCCCCTCGGTGGTAAA
GCGCCCTACAGCAATGCTTTGGTCATTGATGACAAGTATAAAACGATCAACGCCAGTCATTTCCGTACTAGCCAC
ACGCCTCTTCGGAGCCAGAATGAATTTATCGAGGCATATATTGCAGCTCGCCGGATTGCAGATGACATCTCACGG
GAACATGATATCGACGTCTTCCCATATTCCAAATTCTACATCTTCTTTGATCAATACGTTTCCATTGTGCGACTT
ACTGGTACCCTGCTTGGGTCGGCCGTGGCCATCATCTTCGTCTTGACCTCTGTGATATTGGGGTCTATAGCCACG
GGCGCTGTCATTACAACCACAGTGGTTATGATAGTGGTCGATATCATTGGCACTATGGCGATCGCTGGCGTCTCC
TTGAATGCGGTATCTCTTGTCAACTTGGTCATTTGTGTCGGCATTGGTGTTGAGTTCTGTGCTCATATTGCCCGA
GCATTCATGTTCCCCGCTCGACCCATCATGGATAAGGTGCCCGCCGAATTCCGTGGTAAGGACGCTCGAGCATGG
GCGGCCTTGGTCAATGTTGGTGGGACTGTCTTCAGTGGTATTACCGTGACAAAACTTCTCGGAGTTTGCGTCCTG
GCATTTACTCGAAGCAAGATCTTCGAGATCTACTACTTCCGGGTTTGGCTAGCCCTGGTGATTTTTGCTGCTACG
CATGCTCTCATCTTCTTACCAGTGGCTCTCAGCTACTTTGGCGGCGGTGGCTACTTTGACCCTGCCTCCGAAGGT
GGCCTAGAGGCCAATCTCGCTTCACGTGGCTACCGCTCATCGCTACTCCATGATGAATATGAGTCTGATGAATAT
TAA
Gene >Pro_DTO070G2_2|g4254.t1
ATGCGGTTGCCTAGGGCTCTCGCCCTGATCGTTGGGCTGGGCTCTTTTGCACCTACCCTTGTCGGTGCACAGGGC
GAAACTAAAATCCACGAAAAGGGCCGTTGTGCTATTCGAGGTCATTGTGGAAAGCAATCCATTTTTGGAGGTGAA
CTACCCTGTCCAGATAATGACCTGGCGCAACAACCAGAAGACGCAGTACGCCAAAAGTTGGTAAATCTGTGTGGC
AGCAAATGGAGCGAAGGGCCGGTCTGTTGTCGAGATGAACAGGTGAGAGATCCCGGCCTCTGTTTTCGTCAACGA
TAGTATCACTATATTTATAATTCTATCATGCTGATAACCCATAGATCGATGCGCTTTCCAGTAACCTCAAACTAG
CAGAGGGAATTATCGCGTCCTGCCCTGCCTGCCGAGACAACTTCTTCAACATATTCTGTACCTTTACATGCTCCC
CCGATCAATCCCTTTTCATCAATGTCACCAAAACAGAAGAAAACAGATCTGGTAAAAGACTTGTGACCGAGTTGG
ACAATATTTGGTCCGAGGAGTACCAGAACGGCTTCTACGATAGCTGCAAGAACGTAAAGAACGGTGCCTCGGGCG
GGAAAGCCATTGACTTCATCGGCGGTGGTGCGAAAGACGCTCCCCATTTCATGAAGTTTTTAGGTGATAAGAAGT
TTCTCGGGAGCCCGTTCCAGATTAACTATCACACAGAGCCCACTGGGCCTGACCCGCAAGGAATGAAGGCTTTGT
CAATAAAGCCGAAAGCCTGCAATGACGAGGACAAATCATTCCGATGTTCTTGTGTCGACTGCCCGGAAGTGTGTC
CGGAGTTGCCTGCCATCTCCCCCCACAAGATATGTCATGTAGGACTTCTACCATGTCTATCGTTTGCCGTCATTC
TCGTTTATTCCGTCTTTCTATTATTTGTCATTGCTCTCGCGAGCTATGTCACATACAAGGAACGCCGTTTCCGCA
AACCAGAGCGGGTGCGGTTGCTACAAGATCCCACGCCCAGCGATGACGAAGATGAAGGGGAAGTCATGCACCGTG
GAGGATATATGGAAAGATCACATGGAGTATACAAGCTCAACTCTGTGTTGTCAGCTATGTTTCATCGAATCGGTG
GTGCTTGTGCGCGGTTCCCAGCAATAGCAATATTCTCCAGCGTCATCGGAGTGGTGCTGCTGAGCCTAGGGTGGC
TAAATTTCACCGTTGAAACGGATCCGGTGCAACTCTGGGTGAGTCCGTCATCTGCAGCCGCCCAGGAGAAGGATT
TCTTCGATCAGAGCTTTGGTCCATTCTTCCGAGCCGAGCAGGCATTTTTGGTGAATAACCGCCCAGGTAATGACT
CACGTCCGCTCTTGGACTACGAAACCCTTACTTGGTGGTTTGACGTCGAATCTCGTGTGCGACGCGTGATCTCGT
TGGACCAGGCTCTCAATTTCGATGACGTTTGTTTCAAGCCGACTGGAGAAGCTTGTGTCGTGCAATCCTTCACTG
GGTATTTCGGCGGTTCCGTCTCAAACCTTGACCCAGATACATGGAAGGACAGACTTAGCCACTGCACAAAGTCGC
CTGGCGACCCTAGCTGTCTCCCCGATTTCTCGCAGCCCCTCAAGCCCGAAATGATTCTTGGTGGATATGATGACA
CAGGGAATGTTCTGGATGCCCAGGCACTCATTGTGACCTGGGTGGTAAATAATTACGACCAGGGAACAGAAGAAG
AAGCAAAAGCCATTGACTGGGAGAACACTTTCCAGGCCGTTCTCGGGGTAGTCCAAGAAGAGGCTGCCGAGCGAG
GCCTTCGCGTATCTTTTAATTCCGAGGTCAGCTTGGAACAGGAACTGAACAAGTCTACCAACACAGATGCGAAGA
TTGTTGTCATCAGTTACCTGATCATGTTCTTCTACGTCTCAATGGCCCTGGGCTCGGTCACAGTTACCTGGAGGT
CTCTGCTGACCAATCCATCCAATGCTCTTGTTCAGTCTAAATTTACACTGGGGATCGTCGGGATCATCATTGTCC
TGATGTCTGTTTCTGCATCGGTCGGACTGTTCTCGGCAGCGGGCGTCAAGGTGACCTTGATCATTGCTGAAGTAA
TTCCATTCTTGGTCCTGGCAGTCGGAGTAGACAACATTTTCTTGATCGTCCACGAATTCGAGCGAGTCAATATCA
GCCATCCCGATGAAGAAATCGACGAGCGAGTTGCCCGAGCTGTTGGTCGAATCGGACCTAGCATCTTCCTGTCTG
CTCTGACGGAGACAGTAGCCTTTGCCCTGGGCATCTTTGTTGGTATGCCCGCTGTCAAGAATTTTGCCGCATACG
CCGCTGGTGCTGTCTTCATTAACGCCATCCTGCAAATCACCATGTTCATCTCCGTCTTGGCTCTGAACCAGAGAC
GGGTGCAGAGTCTCCGTGCGGACTGTATCCCTTGTCTTACTGTACGCAAAGCAAATTCGTTCGGCTTCCCTGGGG
AGAACTACGATGGCCAGGAAGCAGAGAGCACTTTGCAGGTCTTCATTCGTCGGGTCTATGCGCCTTTCCTCCTGG
ATCGTCGGGTGAAAGTTGGCGTTGTTATATTTTTCTTGGGTCTTTTGACTGCCGGTCTAGCCTTCATCCCCGAGG
TTCCTCTTGGGTTAGATCAGCGTATCGCGCTCCCTAGCGACTCGTATCTGATTTCGTATTTCAACGACCTAGATT
CATACTTTGACACAGGGCCTCCGGTCTATTTCGTGACTCGGAATGTGAATGTTACCGAACGAAGTCACCAACAAC
AGCTCTGTGGACGATTCACCACTTGCGAGGAGTATTCACTTCCCTTTATTCTTGAGCAAGAGTCTAAGCGTCCGA
ATGTTTCTTATCTTGCAGGCTCTGCCGCCAGCTGGATTGATGATTTCTTCTATTGGCTGAACCCCCAGCAAGACT
GTTGCAAAGAAAACGGCAAGCTTTGTTTCGAGGACCGCGTTCCTGCCTGGAACATCTCTCTTTCGGGAATGCCGG
AAGGATCTGAATTTGTCCATTACGCCCAAAAATGGATCGATGCTCCCACCGATGCATCCTGCCCCCTCGGTGGTA
AAGCGCCCTACAGCAATGCTTTGGTCATTGATGACAAGTATAAAACGATCAACGCCAGTCATTTCCGTACTAGCC
ACACGCCTCTTCGGAGCCAGAATGAATTTATCGAGGCATATATTGCAGCTCGCCGGATTGCAGATGACATCTCAC
GGGAACATGATATCGACGTCTTCCCATATTCCAAATTCTACATCTTCTTTGATCAATACGTTTCCATTGTGCGAC
TTACTGGTACCCTGCTTGGGTCGGCCGTGGCCATCATCTTCGTCTTGACCTCTGTGATATTGGGGTCTATAGCCA
CGGGCGCTGTCATTACAACCACAGTGGTTATGATAGTGGTCGATATCATTGGCACTATGGCGATCGCTGGCGTCT
CCTTGAATGCGGTATCTCTTGTCAACTTGGTCATTTGTGTCGGCATTGGTGTTGAGTTCTGTGCTCATATTGCCC
GAGCATTCATGTTCCCCGCTCGACCCATCATGGATAAGGTGCCCGCCGAATTCCGTGGTAAGGACGCTCGAGCAT
GGGCGGCCTTGGTCAATGTTGGTGGGACTGTCTTCAGTGGTATTACCGTGACAAAACTTCTCGGAGTTTGCGTCC
TGGCATTTACTCGAAGCAAGATCTTCGAGATCTACTACTTCCGGGTTTGGCTAGCCCTGGTGATTTTTGCTGCTA
CGCATGCTCTCATCTTCTTACCAGTGGCTCTCAGCTACTTTGGCGGCGGTGGTACGTGCAAATTGACCCATCGCT
ATTGAATAAGGAGAACTCTACTGACATATTTAGGCTACTTTGACCCTGCCTCCGAAGGTGGCCTAGAGGCCAATC
TCGCTTCACGTGGCTACCGCTCATCGCTACTCCATGATGAATATGAGTCTGATGAATATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail