Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g4224.t1
Gene name
Locationscaffold_04:1129889..1133093
Strand-
Gene length (bp)3204
Transcript length (bp)2106
Coding sequence length (bp)2106
Protein length (aa) 702

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 2.8E-17 69 151
PF13847 Methyltransf_31 Methyltransferase domain 4.3E-13 64 140
PF08241 Methyltransf_11 Methyltransferase domain 1.3E-10 70 150
PF00856 SET SET domain 7.4E-06 502 548
PF05175 MTS Methyltransferase small domain 4.8E-06 61 139
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 5.0E-06 62 140
PF02390 Methyltransf_4 Putative methyltransferase 8.2E-06 68 124

GO

GO Term Description Terminal node
GO:0006400 tRNA modification Yes
GO:0008176 tRNA (guanine-N7-)-methyltransferase activity Yes
GO:0005515 protein binding Yes
GO:0008168 methyltransferase activity Yes
GO:0043412 macromolecule modification No
GO:0008150 biological_process No
GO:0008173 RNA methyltransferase activity No
GO:0008152 metabolic process No
GO:0006396 RNA processing No
GO:0016740 transferase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008175 tRNA methyltransferase activity No
GO:0090304 nucleic acid metabolic process No
GO:0006399 tRNA metabolic process No
GO:0044238 primary metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009451 RNA modification No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0003824 catalytic activity No
GO:0016423 tRNA (guanine) methyltransferase activity No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0005488 binding No
GO:0034470 ncRNA processing No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0043170 macromolecule metabolic process No
GO:0008033 tRNA processing No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
CE12 3.4E-29 546 700

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup8692
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g9446.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g8636.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g8451.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g9797.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g9445.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g9214.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g9316.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g9331.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g9318.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g7209.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g8374.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g9368.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g8353.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g8668.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g9633.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g9477.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g9598.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g8983.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g4224.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g9470.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g9440.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g9343.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g9623.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g9294.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g9129.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g8840.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g9516.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g7910.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g9399.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g9231.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g9572.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g9592.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g9574.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g9057.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g4224.t1
MTIPSLGRVASLFPHIEKDWWKKAYNEMYLYTDGDCVEVPAITEAECNDIIGISSVQQLLKTQESSIKVLDLCCG
QGRHSINLAKRFPSVNFYGIDQSTYLLDLARKRAIEENVQSNVTFQKGDLRRIPASDCSFDLVILLGNSFGHCND
EGDLHQSGWEWLEGKEKLLACRERELSPDKTLLASREIVIDLEGPSIRQDLFYSVRLYDLEEMDNLLQRSGLFLQ
AEDGMQITATKRDGPVDMGMMERRQLIVAQKPVKSTAAKPPAVDALEQDADIYVHPNLTQSYNPHKGRLLQVSAF
VSAGTMILADTPYALIPSADPSHPDASICSNLKCRQQVSRDTHREICQRNCIRDVVWCDNRCRTADQARHDFECA
WLKNYGESLRQNEGQYAFAMLWTVMRLLAGRYIELQAGFKPSELYSWEDRFKRGWDSIEILHSNRERWPQTQILH
WKRLVEVYLTHDNQSDLSVDDLVDLICKEESNSFGLYPSDTGIFPIPDPPIERGVDYGLGIYPRASIVNHSCIPN
VIWRADNNGRMVLTTSKDLAAGDDTTATQSSNGGGWGDGLLNTTLFKGASGRNFGHNGATTVSFRSGGYWDEVLT
TVRQVRDDYHPLVTIQFGHDDQKPAANISLSQYTRNLERFVTEASNAGATPILVTPLSRRNYDKSTGTPRIVMSL
ANETLATIIAAHRSNAAYIDLNKTST*
Coding >Pro_DTO070G2_2|g4224.t1
ATGACAATTCCTAGTCTTGGCCGTGTTGCCTCATTGTTTCCTCATATCGAGAAAGATTGGTGGAAGAAGGCCTAC
AATGAGATGTACCTCTACACCGATGGTGACTGTGTCGAAGTCCCCGCAATCACAGAAGCCGAATGCAACGACATC
ATCGGAATATCTAGCGTGCAACAGCTGTTGAAAACCCAAGAATCTTCGATCAAGGTATTGGATCTATGCTGTGGC
CAAGGCCGACATAGCATCAATCTTGCCAAACGCTTTCCATCGGTGAATTTTTACGGCATCGATCAGAGCACATAT
CTCCTTGACCTTGCTCGAAAACGCGCAATAGAAGAAAACGTGCAGAGTAACGTCACGTTTCAGAAGGGAGACCTT
CGTCGGATTCCTGCATCGGATTGTTCCTTTGATCTGGTCATACTTCTGGGAAATTCTTTTGGACACTGTAATGAT
GAAGGAGACCTACATCAAAGTGGATGGGAATGGCTTGAGGGCAAAGAAAAACTTCTGGCCTGCCGGGAACGAGAG
CTGTCTCCCGACAAAACCCTCCTCGCTAGCCGAGAGATTGTGATTGATTTGGAAGGTCCTTCGATCCGCCAAGAT
CTTTTCTATTCCGTCAGACTTTACGATCTGGAGGAAATGGACAACCTTCTCCAAAGATCTGGCCTATTCCTTCAA
GCAGAAGATGGGATGCAGATCACAGCGACCAAGCGAGACGGCCCTGTGGACATGGGTATGATGGAACGCAGGCAG
TTGATCGTTGCACAGAAGCCAGTCAAGTCCACAGCTGCCAAGCCCCCAGCTGTCGATGCTCTGGAGCAAGACGCG
GATATCTACGTGCATCCAAACCTGACACAAAGCTACAATCCTCACAAAGGAAGATTGCTACAAGTCTCGGCATTT
GTGTCAGCCGGTACCATGATTCTGGCAGATACACCATATGCTTTGATCCCGTCTGCGGATCCATCCCATCCTGAT
GCCTCGATTTGCAGTAACCTGAAATGCCGCCAACAAGTGTCACGGGACACACATAGAGAGATTTGCCAAAGGAAT
TGCATCCGGGATGTTGTTTGGTGTGACAATCGTTGTCGGACGGCAGACCAGGCTCGGCATGACTTTGAATGCGCT
TGGTTGAAAAACTACGGAGAAAGTCTTCGTCAAAACGAGGGCCAGTATGCATTTGCCATGCTTTGGACAGTCATG
CGTCTTCTAGCTGGAAGGTACATTGAGTTACAGGCAGGGTTCAAGCCATCTGAGCTCTATTCCTGGGAAGATCGG
TTCAAGCGGGGGTGGGATTCCATTGAGATCCTCCACAGTAACCGGGAGAGGTGGCCTCAGACGCAGATTTTGCAC
TGGAAGAGGCTAGTTGAGGTATATCTAACTCACGATAATCAGTCAGACCTTAGCGTTGATGATCTAGTGGATCTC
ATCTGCAAAGAAGAGTCTAATTCGTTCGGGCTATATCCAAGTGACACTGGGATATTTCCCATTCCGGACCCCCCA
ATCGAACGAGGCGTGGATTATGGCTTGGGTATCTACCCAAGAGCCTCTATAGTCAACCATTCCTGCATTCCAAAT
GTCATCTGGAGAGCAGACAACAATGGGCGGATGGTATTGACTACCTCAAAAGATCTTGCCGCAGGCGACGACACC
ACGGCAACTCAATCCTCGAACGGAGGAGGATGGGGAGATGGACTTCTCAATACAACCCTTTTCAAAGGAGCATCT
GGTCGCAATTTCGGTCACAACGGTGCAACCACTGTTAGCTTCCGGAGCGGAGGTTATTGGGACGAGGTTCTAACA
ACCGTGAGACAAGTTCGAGACGACTATCATCCACTTGTTACAATCCAATTCGGCCACGACGACCAAAAGCCCGCA
GCAAACATTTCATTATCACAATACACCAGGAATCTTGAAAGATTCGTGACTGAGGCCTCTAATGCTGGGGCTACA
CCGATTCTCGTCACTCCTCTATCTCGGCGCAACTACGATAAATCAACAGGGACACCGCGTATCGTCATGAGTCTC
GCCAATGAGACCTTGGCCACCATCATTGCCGCTCATCGCTCAAACGCTGCCTATATTGATCTGAATAAAACTAGC
ACCTAG
Transcript >Pro_DTO070G2_2|g4224.t1
ATGACAATTCCTAGTCTTGGCCGTGTTGCCTCATTGTTTCCTCATATCGAGAAAGATTGGTGGAAGAAGGCCTAC
AATGAGATGTACCTCTACACCGATGGTGACTGTGTCGAAGTCCCCGCAATCACAGAAGCCGAATGCAACGACATC
ATCGGAATATCTAGCGTGCAACAGCTGTTGAAAACCCAAGAATCTTCGATCAAGGTATTGGATCTATGCTGTGGC
CAAGGCCGACATAGCATCAATCTTGCCAAACGCTTTCCATCGGTGAATTTTTACGGCATCGATCAGAGCACATAT
CTCCTTGACCTTGCTCGAAAACGCGCAATAGAAGAAAACGTGCAGAGTAACGTCACGTTTCAGAAGGGAGACCTT
CGTCGGATTCCTGCATCGGATTGTTCCTTTGATCTGGTCATACTTCTGGGAAATTCTTTTGGACACTGTAATGAT
GAAGGAGACCTACATCAAAGTGGATGGGAATGGCTTGAGGGCAAAGAAAAACTTCTGGCCTGCCGGGAACGAGAG
CTGTCTCCCGACAAAACCCTCCTCGCTAGCCGAGAGATTGTGATTGATTTGGAAGGTCCTTCGATCCGCCAAGAT
CTTTTCTATTCCGTCAGACTTTACGATCTGGAGGAAATGGACAACCTTCTCCAAAGATCTGGCCTATTCCTTCAA
GCAGAAGATGGGATGCAGATCACAGCGACCAAGCGAGACGGCCCTGTGGACATGGGTATGATGGAACGCAGGCAG
TTGATCGTTGCACAGAAGCCAGTCAAGTCCACAGCTGCCAAGCCCCCAGCTGTCGATGCTCTGGAGCAAGACGCG
GATATCTACGTGCATCCAAACCTGACACAAAGCTACAATCCTCACAAAGGAAGATTGCTACAAGTCTCGGCATTT
GTGTCAGCCGGTACCATGATTCTGGCAGATACACCATATGCTTTGATCCCGTCTGCGGATCCATCCCATCCTGAT
GCCTCGATTTGCAGTAACCTGAAATGCCGCCAACAAGTGTCACGGGACACACATAGAGAGATTTGCCAAAGGAAT
TGCATCCGGGATGTTGTTTGGTGTGACAATCGTTGTCGGACGGCAGACCAGGCTCGGCATGACTTTGAATGCGCT
TGGTTGAAAAACTACGGAGAAAGTCTTCGTCAAAACGAGGGCCAGTATGCATTTGCCATGCTTTGGACAGTCATG
CGTCTTCTAGCTGGAAGGTACATTGAGTTACAGGCAGGGTTCAAGCCATCTGAGCTCTATTCCTGGGAAGATCGG
TTCAAGCGGGGGTGGGATTCCATTGAGATCCTCCACAGTAACCGGGAGAGGTGGCCTCAGACGCAGATTTTGCAC
TGGAAGAGGCTAGTTGAGGTATATCTAACTCACGATAATCAGTCAGACCTTAGCGTTGATGATCTAGTGGATCTC
ATCTGCAAAGAAGAGTCTAATTCGTTCGGGCTATATCCAAGTGACACTGGGATATTTCCCATTCCGGACCCCCCA
ATCGAACGAGGCGTGGATTATGGCTTGGGTATCTACCCAAGAGCCTCTATAGTCAACCATTCCTGCATTCCAAAT
GTCATCTGGAGAGCAGACAACAATGGGCGGATGGTATTGACTACCTCAAAAGATCTTGCCGCAGGCGACGACACC
ACGGCAACTCAATCCTCGAACGGAGGAGGATGGGGAGATGGACTTCTCAATACAACCCTTTTCAAAGGAGCATCT
GGTCGCAATTTCGGTCACAACGGTGCAACCACTGTTAGCTTCCGGAGCGGAGGTTATTGGGACGAGGTTCTAACA
ACCGTGAGACAAGTTCGAGACGACTATCATCCACTTGTTACAATCCAATTCGGCCACGACGACCAAAAGCCCGCA
GCAAACATTTCATTATCACAATACACCAGGAATCTTGAAAGATTCGTGACTGAGGCCTCTAATGCTGGGGCTACA
CCGATTCTCGTCACTCCTCTATCTCGGCGCAACTACGATAAATCAACAGGGACACCGCGTATCGTCATGAGTCTC
GCCAATGAGACCTTGGCCACCATCATTGCCGCTCATCGCTCAAACGCTGCCTATATTGATCTGAATAAAACTAGC
ACCTAG
Gene >Pro_DTO070G2_2|g4224.t1
ATGACAATTCCTAGTCTTGGCCGTGTTGCCTCATTGTTTCCTCATATCGAGAAAGATTGGTGGAAGAAGGCCTAC
AATGAGATGTACCTCTACACCGATGGTGACTGTGTCGAAGTCCCCGCAATCACAGAAGCCGAATGCAACGACATC
ATCGGAATATCTAGCGTGCAACAGCTGTTGAAAACCCAAGAATCTTCGATCAAGGTATTGGATCTATGCTGTGGC
CAAGGCCGACATAGCATCAATCTTGCCAAACGCTTTCCATCGGTGAATTTTTACGGCATCGATCAGAGCACATAT
CTCCTTGACCTTGCTCGAAAACGCGCAATAGAAGAAAACGTGCAGAGTAACGTCACGTTTCAGAAGGGAGACCTT
CGTCGGATTCCTGCATCGGATTGTTCCTTTGATCTGGTCATACTTCTGGGAAATTCTTTTGGACACTGTAATGAT
GAAGGAGACCTACAGTCCCTCCGGGAGGCCTCTCGGGTCCTGAAACCAGGAGGAATTTTCGTCATTGACCACGTG
GATGGAGCATGGATTTGATCCAACTTCAGTCAAAGTGGATGGGAATGGCTTGAGGGCAAAGAAAAACTTCTGGCC
TGCCGGGAACGAGAGCTGTCTCCCGACAAAACCCTCCTCGCTAGCCGAGAGATTGTGATTGATTTGGAAGGTCCT
TCGATCCGCCAAGATCTTTTCTATTCCGTCAGACTTTACGATCTGGAGGAAATGGACAACCTTCTCCAAAGATCT
GGCCTATTCCTTCAAGCAGAAGATGGGATGCAGATCACAGCGACCAAGCGAGACGGCCCTGTGGACATGGGTATG
ATGGAACGCAGGCAGTTGATCGTTGCACAGAAGCCAGTCAAGTCCACAGCTGCCAAGCCCCCAGCTGTCGATGCT
CTGGAGCAAGACGCGGATATCTACGTGCATCCAAACCTGACACAAAGCTACAATCCTCACAAAGGAAGATTGCTA
CAAGTCTCGGCATTTGTGTCAGCCGGTACCATGATTCTGGCAGATACACCATATGCTTTGATCCCGTCTGCGGAT
CCATCCCATCCTGATGCCTCGATTTGCAGTAACCTGAAATGCCGCCAACAAGTGTCACGGGACACACATAGAGAG
ATTTGCCAAAGGAATTGCATCCGGGATGTTGTTTGGTGTGACAATCGTTGTCGGACGGCAGACCAGGCTCGGCAT
GACTTTGAATGCGCTTGGTTGAAAAACTACGGAGAAAGTCTTCGTCAAAACGAGGGCCAGTATGCATTTGCCATG
CTTTGGACAGTCATGCGTCTTCTAGCTGGAAGGTACATTGAGTTACAGGCAGGGTTCAAGCCATCTGAGCTCTAT
TCCTGGGAAGATCGGTTCAAGCGGGGGTGGGATTCCATTGAGATCCTCCACAGTAACCGGGAGAGGTGGCCTCAG
ACGCAGATTTTGCACTGGAAGAGGCTAGTTGAGGTATATCTAACTCACGATAATCAGTCAGACCTTAGCGTTGAT
GATCTAGTGGATCTCATCTGCAAAGAAGAGTCTAATTCGTTCGGGCTATATCCAAGTGACACTGGGATATTTCCC
ATTCCGGACCCCCCAATCGAACGAGGCGTGGATTATGGCTTGGGTATCTACCCAAGAGCCTCTATAGTCAACCAT
TCCTGCATTCCAAATGTAAGTTACCCCTCGAGAATACTAGATTTCAAACATACTCAAATATCCTAGGTCATCTGG
AGAGCAGACAACAATGGGCGGATGGTATTGACTACCTCAAAAGATCTTGCCGCAGGCGACGAGTGCTTTATTTGC
TATTTTGATCTATGCAAATATGTAGATTTCAAAGCACGGCAAAAGCTGCTGCGAGAAGACTTCCTATTCTCTTGC
GCCTGTGAGCGATGCACTCAAGAACAGGCCGAGGAAATATATGGCCGCTTAGAGTAGCAGTTAGGTCTACCACGT
TCAATTGCAAAACAACTTAAGATGACCGAAAAATATAATGTAACTGATCTTCTGGGTAAGATCCACCGTCAAGGG
CTGTCTGTATATAAGATCACTGAAGACTCTTGCCTCTGCTCGTGGGGGCTTGGGCCCTTGGGGACATCAGTCAGA
GACCTGGAGATGCTCATGAAAGTCTGACCAATGCAGAAGACATGTGAATTTAATTATTCCACCTTGTTTCCTCCA
AGTCCGCCCTACGACTCGGGCTCATCCACCACACAATCCAACAATTCTGCGATGCTTTGAACCTTCACATGTACT
CGATGGATCCAGCTCGGACTCTGCCAGTGGGGGAACCAAACAACCTCATGATCTACCTGGCGTGATGCCCTATAC
TCCTCTGAAATGTGATGGATATACGTTGGCCTTTTCTATTCTCACGGCATTATACTAATTCTTCAAAGAACACAA
CCTGCGCCATTCCGTATTTAGGATGATTGGTGGAATGTCGTCACTCCATTCATGAATCCCAAGCAAATCACTTTC
CTGCATTGAGGAATTCCCACCAATGGGAGGAATGAGTGTATCAACCCACATGTGAGAGCTATAAGTTTATATGAA
AACACTTCTTTCGCGGAGAATGACTCTAACCCCAATAACTCACAAAGGTTGCATCCATGTACACAATAATGGACG
TGATCTGGAAAGCAACCGGAGTAGCCCTCCTCAGTATCCTATCTTACGTTCAGGCATATCCTTCCAGTGCATTTG
CATCCTCGCATAAGACTCCATTTTTTTGTTTTGGTGGGTGATAGCACCACGGCAACTCAATCCTCGAACGGAGGA
GGATGGGGAGATGGACTTCTCAATACAACCCTTTTCAAAGGAGCATCTGGTCGCAATTTCGGTCACAACGGTGCA
ACCACTGTTAGCTTCCGGAGCGGAGGTTATTGGGACGAGGTTCTAACAACCGTGAGACAAGTTCGAGACGACTAT
CATCCACTTGTTACAATCCAATTCGGCCACGACGACCAAAAGCCCGCAGCAAACATTTCATTATCACAATACACC
AGGAATCTTGAAAGATTCGTGACTGAGGCCTCTAATGCTGGGGCTACACCGATTCTCGTCACTCCTCTATCTCGG
CGCAACTACGATAAATCAACAGGGACACCGCGTATCGTCATGAGTCTCGCCAATGAGACCTTGGCCACCATCATT
GCCGCTCATCGCTCAAACGCTGCCTATATTGATCTGAATAAAACTAGCACCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail