Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g404.t1
Gene name
Locationscaffold_01:1063772..1067314
Strand+
Gene length (bp)3542
Transcript length (bp)3486
Coding sequence length (bp)3486
Protein length (aa) 1162

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.0E-15 980 1060
PF12796 Ank_2 Ankyrin repeats (3 copies) 8.1E-11 1033 1094
PF13637 Ank_4 Ankyrin repeats (many copies) 1.6E-07 1003 1053
PF13637 Ank_4 Ankyrin repeats (many copies) 5.5E-10 1034 1084
PF13637 Ank_4 Ankyrin repeats (many copies) 5.0E-07 1108 1150
PF00023 Ank Ankyrin repeat 3.3E-04 1000 1030
PF00023 Ank Ankyrin repeat 1.8E-05 1033 1059
PF00023 Ank Ankyrin repeat 1.5E-02 1065 1094
PF13857 Ank_5 Ankyrin repeats (many copies) 2.9E-06 1019 1059
PF13606 Ank_3 Ankyrin repeat 1.4E-05 1033 1060

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 248 270 22
2 340 357 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g404.t1
MILSILFLLSLLPFVKADDDWDDFTNNLATDLAPLITLFGERLTKQFLSESISTLDNVIFALSPLGVLTAVVSVI
RVCGSSSLRAFVGRAQEGPAEAESELLPCVSESTAEVFNDGGITRVFGRPKIVEIVAWEDVDKITGEKETKIGTL
RDALEEKAWSCNSKVSPTDLPELDMPNLSLNKGIKRRDQFWFHCAAILGGILQTGQCFSSLEPEMMLTIQKGTVV
FATLTVFVYPQHFQKNDKAVAPYAFPLYIIGTTLLFLGMFFCAFIMERSSKEFYLKAEKPSKIYWLQPGNQDVGD
QVFNAFLAVNEGPESSMTDKLRYTKSIRDRRFDRKYLETYSTLISTILGFICQFVGLRGLHSSVTLAQLGSTFLM
AIIRTCLRTERMKPDENKMKDDRELTSHKQQEIDCFAFYLEKVESFELASIPDRPPNMPSQRFTPHLGTPLAKQL
IHTRTQLARLTTSSRQSLGVDWNGMPIRRIASNLAETIESTMDLMSSWGVNLGKTFEFRLGFKCKGPSPGSVTEA
PGTYSIGLIRSGDALQWKLDVAELEAVLGLWTWSLYKSDENWQNSTLCRLIGLSEDEAKKDETFLYFYKWIFRQT
EARLVPSEGYDNSSRLFSFEPKSLPYDGKVLAVRTDNELEAMVAQDIYIQFLKEVFLNLDDLGGDVDVIPELQNS
FLASSTRIDDLIRCFENSKLGSREDALLCIVPVLRYRHLLPDLAADSTKVRARRERLIEKGDWKGAFTLVRWICQ
RSDDSQFERSVHELGFLCRRALSDSNKDVRKIGFEQTCELLTSDIRAEFLQVHNHVPPLQQSVSDDRIEWWNSFS
RQLGWIAWNLSANVPGMEYCKPILRSLNVTEDLQGSNDQNQDPDKIEGAIHALKDWLTLYKLDDIDREGDGEDEQ
ACLEWLVRNNFHALLYFLLLRWVELYEDLPMLVRMGYSFAARIRSQRALDILRRQGADIDMIDPNNCSALSDLVS
THDLEGTRLLLQNGANPNITAQHSGISPLAIAAHEGQDDIVALLLQHGANIDILDEVGHTPLHWACEKNSLDTVR
LLLSHGADIEGSGQRTPLLSVAMKNQLQMAELLIKEGANVNARDAGGNNALRLATPAMNPIPMLQLLVDNGARLD
LRDDQGKTALDYALQTGYTKALSFLRQVSEGGTKEP*
Coding >Pro_DTO070G2_2|g404.t1
ATGATTCTTTCTATACTGTTTTTACTATCCTTGTTACCTTTTGTCAAGGCTGATGATGATTGGGATGATTTCACG
AATAATCTTGCTACGGACTTGGCTCCTTTGATCACCTTGTTCGGCGAACGACTTACGAAACAATTCCTCTCCGAG
TCCATAAGCACTCTTGATAATGTAATATTCGCCCTTTCACCACTAGGGGTTTTGACTGCCGTCGTGTCGGTGATC
AGGGTCTGTGGAAGTTCTTCCCTCAGGGCATTTGTCGGACGAGCACAAGAAGGTCCTGCTGAAGCTGAAAGCGAG
CTGCTTCCTTGTGTCTCGGAGTCCACTGCGGAGGTTTTCAACGATGGCGGCATTACACGAGTCTTTGGCCGGCCC
AAGATCGTGGAGATAGTTGCTTGGGAGGATGTAGACAAGATCACCGGAGAAAAGGAGACGAAGATTGGCACTTTG
AGAGATGCTCTTGAAGAAAAGGCTTGGTCTTGCAATAGCAAAGTTTCACCTACTGACTTGCCTGAACTGGACATG
CCTAATCTGTCATTGAACAAGGGAATCAAAAGGAGAGATCAATTTTGGTTTCATTGTGCTGCAATACTTGGTGGT
ATACTGCAGACTGGTCAGTGCTTCTCCTCCCTTGAGCCTGAAATGATGCTGACGATCCAAAAAGGCACTGTTGTT
TTTGCTACACTCACGGTGTTTGTGTATCCTCAGCATTTCCAGAAAAACGATAAAGCTGTCGCTCCATACGCATTC
CCGCTCTATATAATCGGGACAACCCTTCTGTTTCTCGGAATGTTCTTCTGCGCATTCATCATGGAACGTTCCTCA
AAGGAGTTCTATCTCAAAGCAGAAAAGCCAAGCAAGATATACTGGCTGCAGCCCGGTAATCAAGACGTGGGTGAC
CAGGTCTTTAATGCTTTCTTGGCCGTCAATGAAGGGCCAGAGTCTTCAATGACGGACAAACTCCGCTATACCAAA
TCGATCAGAGATCGAAGATTTGACAGGAAGTATTTGGAGACTTACTCTACCCTCATATCGACAATTTTGGGATTC
ATATGTCAGTTCGTCGGACTGAGAGGTCTCCATTCATCTGTCACCCTAGCCCAACTGGGATCAACATTCCTAATG
GCTATTATACGTACCTGTCTGCGCACGGAAAGAATGAAGCCAGATGAAAATAAGATGAAAGACGACCGGGAACTC
ACGTCTCACAAGCAGCAAGAGATAGATTGTTTTGCATTTTATCTTGAGAAAGTAGAGTCATTTGAACTCGCCTCG
ATCCCAGATCGGCCACCAAATATGCCTTCACAGAGATTCACGCCCCATCTTGGAACACCTCTGGCCAAACAATTA
ATCCACACCAGAACCCAGCTCGCGAGGCTCACGACTAGCTCAAGACAAAGCCTGGGTGTTGACTGGAATGGAATG
CCTATTCGCCGAATTGCCTCCAACCTCGCAGAGACGATCGAGTCGACGATGGATCTAATGTCGAGTTGGGGAGTT
AACCTCGGAAAGACCTTTGAGTTCCGACTTGGCTTTAAGTGCAAGGGACCCTCTCCAGGCTCTGTCACTGAAGCT
CCGGGAACGTATTCAATTGGTCTCATCCGAAGCGGTGATGCTCTGCAGTGGAAACTGGATGTCGCCGAGCTAGAA
GCGGTTCTAGGCTTGTGGACTTGGTCACTTTATAAGTCAGATGAAAACTGGCAGAACTCAACTCTTTGCCGCCTC
ATTGGATTGAGTGAAGATGAGGCAAAAAAAGATGAAACATTCCTCTACTTTTACAAATGGATCTTCAGGCAAACG
GAAGCGAGACTAGTACCATCTGAAGGATATGATAATTCATCACGCCTGTTCAGTTTCGAGCCCAAGAGCCTTCCC
TATGATGGGAAAGTCCTGGCTGTCAGGACAGATAATGAGCTCGAGGCTATGGTAGCCCAGGATATCTACATTCAA
TTCCTCAAGGAGGTCTTCCTCAACTTGGATGATCTGGGCGGGGACGTTGATGTTATTCCCGAATTGCAAAATTCA
TTTTTAGCATCTAGTACCCGCATTGATGATCTCATACGTTGCTTTGAGAACAGCAAATTGGGCTCAAGAGAGGAT
GCACTGCTATGCATTGTTCCCGTCCTCAGGTATCGGCATCTCTTACCAGATCTCGCTGCAGACTCAACCAAGGTC
AGGGCGCGCAGGGAGCGGTTGATCGAGAAAGGTGATTGGAAAGGTGCCTTTACGCTTGTCCGTTGGATTTGCCAG
CGATCAGACGATTCCCAGTTTGAGAGATCAGTCCATGAACTGGGGTTTCTTTGCCGCCGGGCACTTTCGGACAGC
AACAAAGATGTTCGCAAAATAGGATTCGAACAGACATGTGAGCTTCTCACGTCTGACATCAGAGCTGAATTCCTT
CAAGTCCACAACCATGTGCCACCCTTACAACAGTCCGTATCCGATGATCGTATCGAATGGTGGAACTCGTTCTCA
CGTCAGCTTGGGTGGATTGCGTGGAACCTTTCTGCGAATGTTCCAGGAATGGAATACTGCAAACCCATTTTGAGA
TCACTGAATGTAACGGAAGATCTACAGGGGTCAAACGATCAAAACCAAGACCCAGACAAAATCGAAGGGGCGATT
CACGCACTGAAAGATTGGCTCACGTTGTATAAGCTCGATGACATTGACCGCGAAGGAGACGGGGAGGATGAACAA
GCATGCCTTGAATGGCTGGTCAGGAACAACTTCCATGCTTTATTGTATTTCCTTCTGCTGCGATGGGTGGAGCTT
TATGAAGACCTTCCTATGCTTGTTAGGATGGGGTACAGTTTTGCAGCCCGGATTAGGTCTCAACGAGCACTTGAC
ATACTTCGCCGACAGGGCGCAGATATTGATATGATAGATCCAAACAATTGTTCCGCGTTAAGTGATCTCGTTTCC
ACCCATGATCTCGAGGGAACTCGACTGCTACTGCAAAATGGAGCCAACCCAAACATTACAGCGCAACACTCGGGG
ATCAGTCCACTTGCAATTGCTGCTCATGAAGGCCAGGACGATATTGTCGCATTACTTCTACAGCACGGAGCAAAC
ATTGATATTCTAGACGAGGTCGGCCACACTCCCCTACATTGGGCATGCGAAAAGAATAGTCTCGATACTGTCCGG
CTGCTATTATCCCATGGCGCAGATATTGAGGGGTCTGGCCAAAGAACACCGCTCCTATCAGTCGCCATGAAGAAC
CAGCTTCAGATGGCTGAGTTGCTGATCAAAGAAGGAGCGAACGTCAATGCTCGAGATGCCGGAGGCAACAATGCA
CTTCGACTCGCTACCCCTGCAATGAATCCGATTCCGATGCTCCAGTTGCTCGTGGATAACGGAGCCAGGCTTGAC
TTGCGGGATGATCAAGGGAAAACGGCTTTGGATTACGCCCTGCAAACCGGTTATACTAAGGCACTGTCCTTTTTA
CGCCAGGTATCTGAAGGGGGGACCAAGGAGCCGTGA
Transcript >Pro_DTO070G2_2|g404.t1
ATGATTCTTTCTATACTGTTTTTACTATCCTTGTTACCTTTTGTCAAGGCTGATGATGATTGGGATGATTTCACG
AATAATCTTGCTACGGACTTGGCTCCTTTGATCACCTTGTTCGGCGAACGACTTACGAAACAATTCCTCTCCGAG
TCCATAAGCACTCTTGATAATGTAATATTCGCCCTTTCACCACTAGGGGTTTTGACTGCCGTCGTGTCGGTGATC
AGGGTCTGTGGAAGTTCTTCCCTCAGGGCATTTGTCGGACGAGCACAAGAAGGTCCTGCTGAAGCTGAAAGCGAG
CTGCTTCCTTGTGTCTCGGAGTCCACTGCGGAGGTTTTCAACGATGGCGGCATTACACGAGTCTTTGGCCGGCCC
AAGATCGTGGAGATAGTTGCTTGGGAGGATGTAGACAAGATCACCGGAGAAAAGGAGACGAAGATTGGCACTTTG
AGAGATGCTCTTGAAGAAAAGGCTTGGTCTTGCAATAGCAAAGTTTCACCTACTGACTTGCCTGAACTGGACATG
CCTAATCTGTCATTGAACAAGGGAATCAAAAGGAGAGATCAATTTTGGTTTCATTGTGCTGCAATACTTGGTGGT
ATACTGCAGACTGGTCAGTGCTTCTCCTCCCTTGAGCCTGAAATGATGCTGACGATCCAAAAAGGCACTGTTGTT
TTTGCTACACTCACGGTGTTTGTGTATCCTCAGCATTTCCAGAAAAACGATAAAGCTGTCGCTCCATACGCATTC
CCGCTCTATATAATCGGGACAACCCTTCTGTTTCTCGGAATGTTCTTCTGCGCATTCATCATGGAACGTTCCTCA
AAGGAGTTCTATCTCAAAGCAGAAAAGCCAAGCAAGATATACTGGCTGCAGCCCGGTAATCAAGACGTGGGTGAC
CAGGTCTTTAATGCTTTCTTGGCCGTCAATGAAGGGCCAGAGTCTTCAATGACGGACAAACTCCGCTATACCAAA
TCGATCAGAGATCGAAGATTTGACAGGAAGTATTTGGAGACTTACTCTACCCTCATATCGACAATTTTGGGATTC
ATATGTCAGTTCGTCGGACTGAGAGGTCTCCATTCATCTGTCACCCTAGCCCAACTGGGATCAACATTCCTAATG
GCTATTATACGTACCTGTCTGCGCACGGAAAGAATGAAGCCAGATGAAAATAAGATGAAAGACGACCGGGAACTC
ACGTCTCACAAGCAGCAAGAGATAGATTGTTTTGCATTTTATCTTGAGAAAGTAGAGTCATTTGAACTCGCCTCG
ATCCCAGATCGGCCACCAAATATGCCTTCACAGAGATTCACGCCCCATCTTGGAACACCTCTGGCCAAACAATTA
ATCCACACCAGAACCCAGCTCGCGAGGCTCACGACTAGCTCAAGACAAAGCCTGGGTGTTGACTGGAATGGAATG
CCTATTCGCCGAATTGCCTCCAACCTCGCAGAGACGATCGAGTCGACGATGGATCTAATGTCGAGTTGGGGAGTT
AACCTCGGAAAGACCTTTGAGTTCCGACTTGGCTTTAAGTGCAAGGGACCCTCTCCAGGCTCTGTCACTGAAGCT
CCGGGAACGTATTCAATTGGTCTCATCCGAAGCGGTGATGCTCTGCAGTGGAAACTGGATGTCGCCGAGCTAGAA
GCGGTTCTAGGCTTGTGGACTTGGTCACTTTATAAGTCAGATGAAAACTGGCAGAACTCAACTCTTTGCCGCCTC
ATTGGATTGAGTGAAGATGAGGCAAAAAAAGATGAAACATTCCTCTACTTTTACAAATGGATCTTCAGGCAAACG
GAAGCGAGACTAGTACCATCTGAAGGATATGATAATTCATCACGCCTGTTCAGTTTCGAGCCCAAGAGCCTTCCC
TATGATGGGAAAGTCCTGGCTGTCAGGACAGATAATGAGCTCGAGGCTATGGTAGCCCAGGATATCTACATTCAA
TTCCTCAAGGAGGTCTTCCTCAACTTGGATGATCTGGGCGGGGACGTTGATGTTATTCCCGAATTGCAAAATTCA
TTTTTAGCATCTAGTACCCGCATTGATGATCTCATACGTTGCTTTGAGAACAGCAAATTGGGCTCAAGAGAGGAT
GCACTGCTATGCATTGTTCCCGTCCTCAGGTATCGGCATCTCTTACCAGATCTCGCTGCAGACTCAACCAAGGTC
AGGGCGCGCAGGGAGCGGTTGATCGAGAAAGGTGATTGGAAAGGTGCCTTTACGCTTGTCCGTTGGATTTGCCAG
CGATCAGACGATTCCCAGTTTGAGAGATCAGTCCATGAACTGGGGTTTCTTTGCCGCCGGGCACTTTCGGACAGC
AACAAAGATGTTCGCAAAATAGGATTCGAACAGACATGTGAGCTTCTCACGTCTGACATCAGAGCTGAATTCCTT
CAAGTCCACAACCATGTGCCACCCTTACAACAGTCCGTATCCGATGATCGTATCGAATGGTGGAACTCGTTCTCA
CGTCAGCTTGGGTGGATTGCGTGGAACCTTTCTGCGAATGTTCCAGGAATGGAATACTGCAAACCCATTTTGAGA
TCACTGAATGTAACGGAAGATCTACAGGGGTCAAACGATCAAAACCAAGACCCAGACAAAATCGAAGGGGCGATT
CACGCACTGAAAGATTGGCTCACGTTGTATAAGCTCGATGACATTGACCGCGAAGGAGACGGGGAGGATGAACAA
GCATGCCTTGAATGGCTGGTCAGGAACAACTTCCATGCTTTATTGTATTTCCTTCTGCTGCGATGGGTGGAGCTT
TATGAAGACCTTCCTATGCTTGTTAGGATGGGGTACAGTTTTGCAGCCCGGATTAGGTCTCAACGAGCACTTGAC
ATACTTCGCCGACAGGGCGCAGATATTGATATGATAGATCCAAACAATTGTTCCGCGTTAAGTGATCTCGTTTCC
ACCCATGATCTCGAGGGAACTCGACTGCTACTGCAAAATGGAGCCAACCCAAACATTACAGCGCAACACTCGGGG
ATCAGTCCACTTGCAATTGCTGCTCATGAAGGCCAGGACGATATTGTCGCATTACTTCTACAGCACGGAGCAAAC
ATTGATATTCTAGACGAGGTCGGCCACACTCCCCTACATTGGGCATGCGAAAAGAATAGTCTCGATACTGTCCGG
CTGCTATTATCCCATGGCGCAGATATTGAGGGGTCTGGCCAAAGAACACCGCTCCTATCAGTCGCCATGAAGAAC
CAGCTTCAGATGGCTGAGTTGCTGATCAAAGAAGGAGCGAACGTCAATGCTCGAGATGCCGGAGGCAACAATGCA
CTTCGACTCGCTACCCCTGCAATGAATCCGATTCCGATGCTCCAGTTGCTCGTGGATAACGGAGCCAGGCTTGAC
TTGCGGGATGATCAAGGGAAAACGGCTTTGGATTACGCCCTGCAAACCGGTTATACTAAGGCACTGTCCTTTTTA
CGCCAGGTATCTGAAGGGGGGACCAAGGAGCCGTGA
Gene >Pro_DTO070G2_2|g404.t1
ATGATTCTTTCTATACTGTTTTTACTATCCTTGTTACCTTTTGTCAAGGCTGATGATGATTGGGATGATTTCACG
AATAATCTTGCTACGGACTTGGTATGTTTATGTTTATATTGAGGCCTCAAGTGGATGTGCTGATGTTTATCTTCA
AGGCTCCTTTGATCACCTTGTTCGGCGAACGACTTACGAAACAATTCCTCTCCGAGTCCATAAGCACTCTTGATA
ATGTAATATTCGCCCTTTCACCACTAGGGGTTTTGACTGCCGTCGTGTCGGTGATCAGGGTCTGTGGAAGTTCTT
CCCTCAGGGCATTTGTCGGACGAGCACAAGAAGGTCCTGCTGAAGCTGAAAGCGAGCTGCTTCCTTGTGTCTCGG
AGTCCACTGCGGAGGTTTTCAACGATGGCGGCATTACACGAGTCTTTGGCCGGCCCAAGATCGTGGAGATAGTTG
CTTGGGAGGATGTAGACAAGATCACCGGAGAAAAGGAGACGAAGATTGGCACTTTGAGAGATGCTCTTGAAGAAA
AGGCTTGGTCTTGCAATAGCAAAGTTTCACCTACTGACTTGCCTGAACTGGACATGCCTAATCTGTCATTGAACA
AGGGAATCAAAAGGAGAGATCAATTTTGGTTTCATTGTGCTGCAATACTTGGTGGTATACTGCAGACTGGTCAGT
GCTTCTCCTCCCTTGAGCCTGAAATGATGCTGACGATCCAAAAAGGCACTGTTGTTTTTGCTACACTCACGGTGT
TTGTGTATCCTCAGCATTTCCAGAAAAACGATAAAGCTGTCGCTCCATACGCATTCCCGCTCTATATAATCGGGA
CAACCCTTCTGTTTCTCGGAATGTTCTTCTGCGCATTCATCATGGAACGTTCCTCAAAGGAGTTCTATCTCAAAG
CAGAAAAGCCAAGCAAGATATACTGGCTGCAGCCCGGTAATCAAGACGTGGGTGACCAGGTCTTTAATGCTTTCT
TGGCCGTCAATGAAGGGCCAGAGTCTTCAATGACGGACAAACTCCGCTATACCAAATCGATCAGAGATCGAAGAT
TTGACAGGAAGTATTTGGAGACTTACTCTACCCTCATATCGACAATTTTGGGATTCATATGTCAGTTCGTCGGAC
TGAGAGGTCTCCATTCATCTGTCACCCTAGCCCAACTGGGATCAACATTCCTAATGGCTATTATACGTACCTGTC
TGCGCACGGAAAGAATGAAGCCAGATGAAAATAAGATGAAAGACGACCGGGAACTCACGTCTCACAAGCAGCAAG
AGATAGATTGTTTTGCATTTTATCTTGAGAAAGTAGAGTCATTTGAACTCGCCTCGATCCCAGATCGGCCACCAA
ATATGCCTTCACAGAGATTCACGCCCCATCTTGGAACACCTCTGGCCAAACAATTAATCCACACCAGAACCCAGC
TCGCGAGGCTCACGACTAGCTCAAGACAAAGCCTGGGTGTTGACTGGAATGGAATGCCTATTCGCCGAATTGCCT
CCAACCTCGCAGAGACGATCGAGTCGACGATGGATCTAATGTCGAGTTGGGGAGTTAACCTCGGAAAGACCTTTG
AGTTCCGACTTGGCTTTAAGTGCAAGGGACCCTCTCCAGGCTCTGTCACTGAAGCTCCGGGAACGTATTCAATTG
GTCTCATCCGAAGCGGTGATGCTCTGCAGTGGAAACTGGATGTCGCCGAGCTAGAAGCGGTTCTAGGCTTGTGGA
CTTGGTCACTTTATAAGTCAGATGAAAACTGGCAGAACTCAACTCTTTGCCGCCTCATTGGATTGAGTGAAGATG
AGGCAAAAAAAGATGAAACATTCCTCTACTTTTACAAATGGATCTTCAGGCAAACGGAAGCGAGACTAGTACCAT
CTGAAGGATATGATAATTCATCACGCCTGTTCAGTTTCGAGCCCAAGAGCCTTCCCTATGATGGGAAAGTCCTGG
CTGTCAGGACAGATAATGAGCTCGAGGCTATGGTAGCCCAGGATATCTACATTCAATTCCTCAAGGAGGTCTTCC
TCAACTTGGATGATCTGGGCGGGGACGTTGATGTTATTCCCGAATTGCAAAATTCATTTTTAGCATCTAGTACCC
GCATTGATGATCTCATACGTTGCTTTGAGAACAGCAAATTGGGCTCAAGAGAGGATGCACTGCTATGCATTGTTC
CCGTCCTCAGGTATCGGCATCTCTTACCAGATCTCGCTGCAGACTCAACCAAGGTCAGGGCGCGCAGGGAGCGGT
TGATCGAGAAAGGTGATTGGAAAGGTGCCTTTACGCTTGTCCGTTGGATTTGCCAGCGATCAGACGATTCCCAGT
TTGAGAGATCAGTCCATGAACTGGGGTTTCTTTGCCGCCGGGCACTTTCGGACAGCAACAAAGATGTTCGCAAAA
TAGGATTCGAACAGACATGTGAGCTTCTCACGTCTGACATCAGAGCTGAATTCCTTCAAGTCCACAACCATGTGC
CACCCTTACAACAGTCCGTATCCGATGATCGTATCGAATGGTGGAACTCGTTCTCACGTCAGCTTGGGTGGATTG
CGTGGAACCTTTCTGCGAATGTTCCAGGAATGGAATACTGCAAACCCATTTTGAGATCACTGAATGTAACGGAAG
ATCTACAGGGGTCAAACGATCAAAACCAAGACCCAGACAAAATCGAAGGGGCGATTCACGCACTGAAAGATTGGC
TCACGTTGTATAAGCTCGATGACATTGACCGCGAAGGAGACGGGGAGGATGAACAAGCATGCCTTGAATGGCTGG
TCAGGAACAACTTCCATGCTTTATTGTATTTCCTTCTGCTGCGATGGGTGGAGCTTTATGAAGACCTTCCTATGC
TTGTTAGGATGGGGTACAGTTTTGCAGCCCGGATTAGGTCTCAACGAGCACTTGACATACTTCGCCGACAGGGCG
CAGATATTGATATGATAGATCCAAACAATTGTTCCGCGTTAAGTGATCTCGTTTCCACCCATGATCTCGAGGGAA
CTCGACTGCTACTGCAAAATGGAGCCAACCCAAACATTACAGCGCAACACTCGGGGATCAGTCCACTTGCAATTG
CTGCTCATGAAGGCCAGGACGATATTGTCGCATTACTTCTACAGCACGGAGCAAACATTGATATTCTAGACGAGG
TCGGCCACACTCCCCTACATTGGGCATGCGAAAAGAATAGTCTCGATACTGTCCGGCTGCTATTATCCCATGGCG
CAGATATTGAGGGGTCTGGCCAAAGAACACCGCTCCTATCAGTCGCCATGAAGAACCAGCTTCAGATGGCTGAGT
TGCTGATCAAAGAAGGAGCGAACGTCAATGCTCGAGATGCCGGAGGCAACAATGCACTTCGACTCGCTACCCCTG
CAATGAATCCGATTCCGATGCTCCAGTTGCTCGTGGATAACGGAGCCAGGCTTGACTTGCGGGATGATCAAGGGA
AAACGGCTTTGGATTACGCCCTGCAAACCGGTTATACTAAGGCACTGTCCTTTTTACGCCAGGTATCTGAAGGGG
GGACCAAGGAGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail