Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g4009.t1
Gene name
Locationscaffold_04:532158..534192
Strand+
Gene length (bp)2034
Transcript length (bp)2034
Coding sequence length (bp)2034
Protein length (aa) 678

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07676 PD40 WD40-like Beta Propeller Repeat 1.4E-06 91 128
PF07676 PD40 WD40-like Beta Propeller Repeat 2.3E-02 136 173
PF07676 PD40 WD40-like Beta Propeller Repeat 1.4E-06 201 219
PF07676 PD40 WD40-like Beta Propeller Repeat 6.8E-02 267 280
PF07676 PD40 WD40-like Beta Propeller Repeat 4.3E-03 457 470
PF07676 PD40 WD40-like Beta Propeller Repeat 4.4E-04 560 588

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g4009.t1
MRLSIITVVGLAIAPVLANCPYARDAGSEVDNSANLHAHLPRDATRSKPTTGVASPLPSAAAGKKGLLLMNRIAP
GTSELYIANADGTNERPLLKDPGYEYHAEFSPDGEWISFTSERDGDGNSDIWRVHPDGSDLQPIVKSPAAEDSVV
ISPNGTLAAYVSTANKYNANIWVKNLETGAEWNITDTPANRPDEDMMHGHFRPAWSPDGDWLAFSSDRNTIWDGH
GKPTYLGLAGWEHTQELGIYIIRPDGSDLRLVAHRASHCLGSPKWSPDGKRLIFYEMTRNGTWDAHRPELVADGN
STIVSIGINGNDRRTEVGGPGIKTFPQYVTNSTIGYHLKGGDKEGLYLTNGTYVNTTIRSPSWSTDGKYVVYEKA
VWSIRPLFKELYSWDSEWDYRFTDIFPQLSSNDRVAMTEKQLGNSSIATFDLEDRHASLVYKPNDTSLIDTTLIG
EGLAGAYNPSWSPDGEWIVFGVGAWFEARDWRGGWILRSTANGSHTEVLTTSKLFINQTKYLNTGFPSFSHDGKK
VVYRVWGAETAKYGDETEIGLRMIDIETREITQLTSGWDNLPSFSPDGEFIVFTRKVSPTNYDVCIIRPDGTDFR
ILTSSGANDAHAVWRQDGKIMWSSGMYGFQYECALYEETFQPYGQIMIMDPDGSNKRALTNSIWEDSMPLFLPND
WF*
Coding >Pro_DTO070G2_2|g4009.t1
ATGCGTTTGAGCATTATTACTGTCGTGGGCCTCGCAATCGCCCCTGTGTTAGCTAATTGCCCTTATGCCCGAGAT
GCGGGTTCCGAGGTTGACAACAGTGCTAACCTTCATGCTCACTTGCCTCGCGATGCCACTCGAAGCAAGCCAACC
ACAGGTGTTGCATCTCCTCTCCCTTCCGCAGCAGCTGGGAAAAAAGGTCTGCTGTTGATGAACCGCATTGCCCCC
GGTACCTCAGAATTATACATCGCCAACGCGGACGGCACCAACGAGCGTCCTCTGTTGAAAGATCCCGGTTATGAA
TATCACGCTGAGTTTTCTCCCGACGGTGAATGGATTAGCTTCACTAGTGAGCGTGACGGTGATGGAAACTCCGAT
ATCTGGAGAGTGCACCCAGATGGCTCCGATCTACAGCCGATTGTGAAATCCCCAGCAGCGGAAGACAGCGTTGTC
ATCTCACCCAATGGAACATTAGCAGCATATGTTTCAACTGCTAACAAGTACAACGCTAATATTTGGGTTAAGAAC
TTGGAGACCGGTGCCGAGTGGAACATCACCGATACCCCGGCTAACCGACCAGATGAGGACATGATGCACGGGCAC
TTTCGTCCAGCCTGGTCACCAGACGGAGATTGGCTTGCATTTTCCTCAGATCGCAACACAATATGGGATGGCCAC
GGAAAACCTACGTATCTTGGCCTCGCTGGCTGGGAGCATACCCAAGAACTCGGCATTTATATTATTCGCCCCGAT
GGTTCAGATCTGCGCCTTGTCGCCCACCGTGCTTCCCACTGCCTTGGGTCTCCCAAATGGTCACCTGATGGCAAG
CGCCTCATATTCTACGAGATGACTCGTAATGGGACGTGGGATGCACATAGACCTGAGCTCGTGGCAGATGGTAAC
TCCACAATTGTGTCTATTGGGATCAATGGCAATGACCGTCGAACCGAGGTTGGCGGTCCTGGTATCAAGACCTTT
CCCCAGTACGTGACCAACTCCACCATTGGGTACCATCTGAAGGGCGGCGATAAGGAGGGCTTGTATCTCACAAAC
GGTACTTACGTCAACACCACTATTCGCTCTCCCTCATGGTCTACTGATGGAAAGTATGTGGTTTACGAGAAAGCT
GTTTGGTCTATCCGCCCTCTCTTCAAGGAGCTTTACAGCTGGGATAGCGAATGGGATTACCGCTTCACTGATATA
TTCCCTCAATTATCGTCGAACGACCGCGTGGCTATGACTGAAAAGCAACTTGGCAACTCCTCCATTGCAACCTTT
GATCTAGAGGATAGACATGCCTCCTTGGTATATAAGCCTAATGATACGAGTCTAATCGACACTACTCTAATTGGA
GAAGGCCTGGCCGGGGCCTACAATCCCAGCTGGTCTCCAGACGGCGAGTGGATTGTCTTCGGAGTAGGTGCCTGG
TTTGAGGCGCGTGATTGGCGAGGAGGCTGGATTTTACGCTCCACCGCAAACGGCAGCCACACCGAGGTCCTCACC
ACCAGCAAGCTCTTTATCAATCAAACCAAGTACCTCAACACCGGCTTTCCCAGCTTCTCGCACGATGGCAAGAAG
GTCGTCTACCGCGTGTGGGGTGCCGAGACCGCCAAGTACGGCGACGAAACAGAGATTGGTTTACGCATGATCGAC
ATTGAGACCAGAGAGATTACCCAGCTTACCAGCGGCTGGGATAACCTTCCCTCTTTCTCGCCCGATGGTGAATTT
ATAGTGTTTACCCGCAAGGTTTCTCCGACCAACTACGACGTCTGCATCATCCGCCCTGACGGTACTGATTTCCGC
ATTCTGACTTCCAGCGGCGCCAACGATGCCCACGCTGTTTGGCGCCAGGATGGAAAAATTATGTGGTCCTCCGGC
ATGTATGGATTCCAGTATGAGTGCGCTTTGTATGAGGAGACTTTCCAGCCCTACGGTCAGATCATGATCATGGAT
CCCGATGGATCCAATAAGCGTGCTTTGACTAATTCCATTTGGGAGGATTCCATGCCGCTCTTTCTTCCTAACGAT
TGGTTCTAG
Transcript >Pro_DTO070G2_2|g4009.t1
ATGCGTTTGAGCATTATTACTGTCGTGGGCCTCGCAATCGCCCCTGTGTTAGCTAATTGCCCTTATGCCCGAGAT
GCGGGTTCCGAGGTTGACAACAGTGCTAACCTTCATGCTCACTTGCCTCGCGATGCCACTCGAAGCAAGCCAACC
ACAGGTGTTGCATCTCCTCTCCCTTCCGCAGCAGCTGGGAAAAAAGGTCTGCTGTTGATGAACCGCATTGCCCCC
GGTACCTCAGAATTATACATCGCCAACGCGGACGGCACCAACGAGCGTCCTCTGTTGAAAGATCCCGGTTATGAA
TATCACGCTGAGTTTTCTCCCGACGGTGAATGGATTAGCTTCACTAGTGAGCGTGACGGTGATGGAAACTCCGAT
ATCTGGAGAGTGCACCCAGATGGCTCCGATCTACAGCCGATTGTGAAATCCCCAGCAGCGGAAGACAGCGTTGTC
ATCTCACCCAATGGAACATTAGCAGCATATGTTTCAACTGCTAACAAGTACAACGCTAATATTTGGGTTAAGAAC
TTGGAGACCGGTGCCGAGTGGAACATCACCGATACCCCGGCTAACCGACCAGATGAGGACATGATGCACGGGCAC
TTTCGTCCAGCCTGGTCACCAGACGGAGATTGGCTTGCATTTTCCTCAGATCGCAACACAATATGGGATGGCCAC
GGAAAACCTACGTATCTTGGCCTCGCTGGCTGGGAGCATACCCAAGAACTCGGCATTTATATTATTCGCCCCGAT
GGTTCAGATCTGCGCCTTGTCGCCCACCGTGCTTCCCACTGCCTTGGGTCTCCCAAATGGTCACCTGATGGCAAG
CGCCTCATATTCTACGAGATGACTCGTAATGGGACGTGGGATGCACATAGACCTGAGCTCGTGGCAGATGGTAAC
TCCACAATTGTGTCTATTGGGATCAATGGCAATGACCGTCGAACCGAGGTTGGCGGTCCTGGTATCAAGACCTTT
CCCCAGTACGTGACCAACTCCACCATTGGGTACCATCTGAAGGGCGGCGATAAGGAGGGCTTGTATCTCACAAAC
GGTACTTACGTCAACACCACTATTCGCTCTCCCTCATGGTCTACTGATGGAAAGTATGTGGTTTACGAGAAAGCT
GTTTGGTCTATCCGCCCTCTCTTCAAGGAGCTTTACAGCTGGGATAGCGAATGGGATTACCGCTTCACTGATATA
TTCCCTCAATTATCGTCGAACGACCGCGTGGCTATGACTGAAAAGCAACTTGGCAACTCCTCCATTGCAACCTTT
GATCTAGAGGATAGACATGCCTCCTTGGTATATAAGCCTAATGATACGAGTCTAATCGACACTACTCTAATTGGA
GAAGGCCTGGCCGGGGCCTACAATCCCAGCTGGTCTCCAGACGGCGAGTGGATTGTCTTCGGAGTAGGTGCCTGG
TTTGAGGCGCGTGATTGGCGAGGAGGCTGGATTTTACGCTCCACCGCAAACGGCAGCCACACCGAGGTCCTCACC
ACCAGCAAGCTCTTTATCAATCAAACCAAGTACCTCAACACCGGCTTTCCCAGCTTCTCGCACGATGGCAAGAAG
GTCGTCTACCGCGTGTGGGGTGCCGAGACCGCCAAGTACGGCGACGAAACAGAGATTGGTTTACGCATGATCGAC
ATTGAGACCAGAGAGATTACCCAGCTTACCAGCGGCTGGGATAACCTTCCCTCTTTCTCGCCCGATGGTGAATTT
ATAGTGTTTACCCGCAAGGTTTCTCCGACCAACTACGACGTCTGCATCATCCGCCCTGACGGTACTGATTTCCGC
ATTCTGACTTCCAGCGGCGCCAACGATGCCCACGCTGTTTGGCGCCAGGATGGAAAAATTATGTGGTCCTCCGGC
ATGTATGGATTCCAGTATGAGTGCGCTTTGTATGAGGAGACTTTCCAGCCCTACGGTCAGATCATGATCATGGAT
CCCGATGGATCCAATAAGCGTGCTTTGACTAATTCCATTTGGGAGGATTCCATGCCGCTCTTTCTTCCTAACGAT
TGGTTCTAG
Gene >Pro_DTO070G2_2|g4009.t1
ATGCGTTTGAGCATTATTACTGTCGTGGGCCTCGCAATCGCCCCTGTGTTAGCTAATTGCCCTTATGCCCGAGAT
GCGGGTTCCGAGGTTGACAACAGTGCTAACCTTCATGCTCACTTGCCTCGCGATGCCACTCGAAGCAAGCCAACC
ACAGGTGTTGCATCTCCTCTCCCTTCCGCAGCAGCTGGGAAAAAAGGTCTGCTGTTGATGAACCGCATTGCCCCC
GGTACCTCAGAATTATACATCGCCAACGCGGACGGCACCAACGAGCGTCCTCTGTTGAAAGATCCCGGTTATGAA
TATCACGCTGAGTTTTCTCCCGACGGTGAATGGATTAGCTTCACTAGTGAGCGTGACGGTGATGGAAACTCCGAT
ATCTGGAGAGTGCACCCAGATGGCTCCGATCTACAGCCGATTGTGAAATCCCCAGCAGCGGAAGACAGCGTTGTC
ATCTCACCCAATGGAACATTAGCAGCATATGTTTCAACTGCTAACAAGTACAACGCTAATATTTGGGTTAAGAAC
TTGGAGACCGGTGCCGAGTGGAACATCACCGATACCCCGGCTAACCGACCAGATGAGGACATGATGCACGGGCAC
TTTCGTCCAGCCTGGTCACCAGACGGAGATTGGCTTGCATTTTCCTCAGATCGCAACACAATATGGGATGGCCAC
GGAAAACCTACGTATCTTGGCCTCGCTGGCTGGGAGCATACCCAAGAACTCGGCATTTATATTATTCGCCCCGAT
GGTTCAGATCTGCGCCTTGTCGCCCACCGTGCTTCCCACTGCCTTGGGTCTCCCAAATGGTCACCTGATGGCAAG
CGCCTCATATTCTACGAGATGACTCGTAATGGGACGTGGGATGCACATAGACCTGAGCTCGTGGCAGATGGTAAC
TCCACAATTGTGTCTATTGGGATCAATGGCAATGACCGTCGAACCGAGGTTGGCGGTCCTGGTATCAAGACCTTT
CCCCAGTACGTGACCAACTCCACCATTGGGTACCATCTGAAGGGCGGCGATAAGGAGGGCTTGTATCTCACAAAC
GGTACTTACGTCAACACCACTATTCGCTCTCCCTCATGGTCTACTGATGGAAAGTATGTGGTTTACGAGAAAGCT
GTTTGGTCTATCCGCCCTCTCTTCAAGGAGCTTTACAGCTGGGATAGCGAATGGGATTACCGCTTCACTGATATA
TTCCCTCAATTATCGTCGAACGACCGCGTGGCTATGACTGAAAAGCAACTTGGCAACTCCTCCATTGCAACCTTT
GATCTAGAGGATAGACATGCCTCCTTGGTATATAAGCCTAATGATACGAGTCTAATCGACACTACTCTAATTGGA
GAAGGCCTGGCCGGGGCCTACAATCCCAGCTGGTCTCCAGACGGCGAGTGGATTGTCTTCGGAGTAGGTGCCTGG
TTTGAGGCGCGTGATTGGCGAGGAGGCTGGATTTTACGCTCCACCGCAAACGGCAGCCACACCGAGGTCCTCACC
ACCAGCAAGCTCTTTATCAATCAAACCAAGTACCTCAACACCGGCTTTCCCAGCTTCTCGCACGATGGCAAGAAG
GTCGTCTACCGCGTGTGGGGTGCCGAGACCGCCAAGTACGGCGACGAAACAGAGATTGGTTTACGCATGATCGAC
ATTGAGACCAGAGAGATTACCCAGCTTACCAGCGGCTGGGATAACCTTCCCTCTTTCTCGCCCGATGGTGAATTT
ATAGTGTTTACCCGCAAGGTTTCTCCGACCAACTACGACGTCTGCATCATCCGCCCTGACGGTACTGATTTCCGC
ATTCTGACTTCCAGCGGCGCCAACGATGCCCACGCTGTTTGGCGCCAGGATGGAAAAATTATGTGGTCCTCCGGC
ATGTATGGATTCCAGTATGAGTGCGCTTTGTATGAGGAGACTTTCCAGCCCTACGGTCAGATCATGATCATGGAT
CCCGATGGATCCAATAAGCGTGCTTTGACTAATTCCATTTGGGAGGATTCCATGCCGCTCTTTCTTCCTAACGAT
TGGTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail