Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g3978.t1
Gene name
Locationscaffold_04:461515..462723
Strand+
Gene length (bp)1208
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 1.3E-13 81 127
PF01328 Peroxidase_2 Peroxidase, family 2 1.7E-11 140 250

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0016491 oxidoreductase activity No
GO:0016209 antioxidant activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g3978.t1
MNLVAIICLWLTVVYCYPGGFDWDQAARYHQQQVLRDDNDRGFGLNEPFVPIPAHILPEKQPFIIDGSIHFYEKH
LNGSGPDGSYRRSSCPAVNSLANRGYINRSGRNITYAELAHAVRRVWNFGDDNDDHVQYVINCPAAPTRNDRAVG
DNININMTLFESLLSFSKDGETLSLEDMAEHHHLRHNQSKIENPDFIFGNQGAICSLAQYTNMVGVLGKFGKHGR
TTLFIDDVKTFYLDEDIPRNYERREAPHYSPESNAMIDRMAHHVGYTIQRPFPEGIRIPVWTFVR*
Coding >Pro_DTO070G2_2|g3978.t1
ATGAATCTTGTCGCCATTATCTGTTTGTGGCTTACCGTTGTCTACTGCTATCCCGGCGGATTTGACTGGGACCAA
GCTGCTAGATATCACCAGCAGCAAGTCCTTCGTGATGACAATGACCGAGGGTTTGGCTTGAACGAGCCGTTCGTC
CCAATTCCCGCTCATATTCTCCCCGAGAAGCAGCCCTTCATCATTGACGGATCCATTCATTTCTACGAAAAGCAT
CTCAATGGCTCCGGCCCAGATGGGAGCTACCGTCGCTCATCTTGTCCGGCCGTGAATTCGTTGGCAAACCGCGGA
TATATCAATCGGTCCGGAAGAAATATCACTTATGCTGAGCTAGCGCACGCAGTTCGCCGAGTGTGGAACTTCGGG
GATGACAATGATGACCATGTTCAATACGTGATTAATTGCCCGGCCGCACCAACCCGCAATGACCGCGCAGTGGGT
GACAACATTAACATCAACATGACTCTCTTCGAGTCCCTGTTGTCCTTCTCCAAGGATGGCGAAACCTTGTCCCTA
GAGGATATGGCGGAGCACCATCACCTACGCCACAACCAAAGTAAAATCGAGAACCCGGACTTCATCTTTGGCAAT
CAAGGAGCAATTTGCTCACTTGCCCAATACACAAATATGGTCGGGGTTCTCGGCAAGTTTGGTAAACATGGCCGA
ACCACCCTATTCATTGACGATGTCAAGACTTTCTATCTTGACGAGGATATTCCTCGGAACTATGAGCGCAGAGAA
GCACCCCATTATTCTCCCGAGTCAAATGCAATGATTGACCGCATGGCGCATCATGTTGGCTACACTATTCAACGA
CCGTTCCCGGAGGGGATCAGAATCCCGGTGTGGACATTTGTCCGATGA
Transcript >Pro_DTO070G2_2|g3978.t1
ATGAATCTTGTCGCCATTATCTGTTTGTGGCTTACCGTTGTCTACTGCTATCCCGGCGGATTTGACTGGGACCAA
GCTGCTAGATATCACCAGCAGCAAGTCCTTCGTGATGACAATGACCGAGGGTTTGGCTTGAACGAGCCGTTCGTC
CCAATTCCCGCTCATATTCTCCCCGAGAAGCAGCCCTTCATCATTGACGGATCCATTCATTTCTACGAAAAGCAT
CTCAATGGCTCCGGCCCAGATGGGAGCTACCGTCGCTCATCTTGTCCGGCCGTGAATTCGTTGGCAAACCGCGGA
TATATCAATCGGTCCGGAAGAAATATCACTTATGCTGAGCTAGCGCACGCAGTTCGCCGAGTGTGGAACTTCGGG
GATGACAATGATGACCATGTTCAATACGTGATTAATTGCCCGGCCGCACCAACCCGCAATGACCGCGCAGTGGGT
GACAACATTAACATCAACATGACTCTCTTCGAGTCCCTGTTGTCCTTCTCCAAGGATGGCGAAACCTTGTCCCTA
GAGGATATGGCGGAGCACCATCACCTACGCCACAACCAAAGTAAAATCGAGAACCCGGACTTCATCTTTGGCAAT
CAAGGAGCAATTTGCTCACTTGCCCAATACACAAATATGGTCGGGGTTCTCGGCAAGTTTGGTAAACATGGCCGA
ACCACCCTATTCATTGACGATGTCAAGACTTTCTATCTTGACGAGGATATTCCTCGGAACTATGAGCGCAGAGAA
GCACCCCATTATTCTCCCGAGTCAAATGCAATGATTGACCGCATGGCGCATCATGTTGGCTACACTATTCAACGA
CCGTTCCCGGAGGGGATCAGAATCCCGGTGTGGACATTTGTCCGATGA
Gene >Pro_DTO070G2_2|g3978.t1
ATGAATCTTGTCGCCATTATCTGTTTGTGGCTTACCGTTGTCTACTGCTATCCCGGCGGATTTGACTGGGACCAA
GCTGCTAGATATCACCAGCAGCAAGTCCTTCGTGATGACAATGACCGAGGGTTTGGCTTGAACGAGCCGTTCGTC
CCAATTCCCGCTCATATTCTCCCCGAGAAGCAGCCCTTCATCATTGACGGATCCATTCATTTCTACGAAAAGCAT
CTCAATGGCTCCGGCCCAGATGGGAGCTACCGTCGCTCATCTTGTCCGGCCGTGAATTCGTTGGCAAACCGCGGA
TATATCAATCGGTCCGGAAGAAATATCACTTATGCTGAGCTAGCGCACGCAGTTCGCCGAGTGTGGAACTTCGGG
GATGACAATGTGAAAACCTCTTTCCCCCGAAATCAAAGTATAATTCGCATTCGTATTCCTGCTGACTTGTGGGGG
TAGAGTATGTTAGTGCTGGCGCCAACTTTTGCAATGCATGGATGGCCTGAAACGATTGATTTGGATTACTTCAAT
GCATGATACCCATAGCTCCCCCTGGTTCCCTCGTGCTAGACACTAATAAGTCTTTCTAGGATGACCATGTTCAAT
ACGTGATTAATTGCCCGGCCGCACCAACCCGCAATGACCGCGCAGTGGGTGACAACATTAACATCAACATGACTC
TCTTCGAGTCCCTGTTGTCCTTCTCCAAGGATGGCGAAACCTTGTCCCTAGAGGATATGGCGGAGCACCATCACC
TACGCCACAACCAAAGTAAAATCGAGAACCCGGACTTCATCTTTGGCAATCAAGGAGCAATTTGCTCACTGTAAG
TATTAGGTAGTGGCCAATACTCCCCAACTACCCCAGGCCCAATATTCAAGACATACGTTCTGACAAAGGCAGTGC
CCAATACACAAATATGGTCGGGGTTCTCGGCAAGTTTGGTAAACATGGCCGAACCACCCTATTCATTGACGATGT
CAAGACTTTCTATCTTGACGAGGATATTCCTCGGAACTATGAGCGCAGAGAAGCACCCGTGAGTTATACTATGCT
TGTGCCCTTGTAAATAGTATCCTTACTAAAAGACATGACAGCATTATTCTCCCGAGTCAAATGCAATGATTGACC
GCATGGCGCATCATGTTGGCTACACTATTCAACGACCGTTCCCGGAGGGGATCAGAATCCCGGTGTGGACATTTG
TCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail