Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g3977.t1
Gene name
Locationscaffold_04:459014..460951
Strand-
Gene length (bp)1937
Transcript length (bp)1830
Coding sequence length (bp)1830
Protein length (aa) 610

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00305 Lipoxygenase Lipoxygenase 9.0E-18 259 504

GO

GO Term Description Terminal node
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen Yes
GO:0046872 metal ion binding Yes
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0051213 dioxygenase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g3977.t1
MTLFPIYKLLLSFLYIGNAVAWPIISVQSVLKPFAALPDDNGPKYSLPMFDTRSWERVDEIRLARAGYIYGPPLL
GNTSFFPTGVLGEAMVARDRVAWFKDVEYVTNNVYLELDKAAAALIKVGGIQSLSSYEILYKDQWASSLPDGVSP
GMLTNWTQDLLFSMERLSTNPYVVRRLHPRIGSLPFPVEDGVVQHLAEGRTLADLHQEGRLFYADHSYQAPYPKT
PGRWTAACTAYFYIHPGSGDFLPLAIKTNMGKNLTYTPRDDANDWLFAKMAFGMNDLFHSQLYHLANTHDVAEPV
HQAALRTMSSRHPVRGYLDRLMYQAYAVRPIGEEFLFNEGGFYDSSFAVPNWAGKKFATDAYWEHAGHFRSTNFY
RDFADRGLLDCAYGPPLRSFPFYETVAPMVQAIEDFTRSFVEYSYPKSSLMGSDHELQAWIMEATSEAQVIDFFP
APLFAREDLVSILSHMAFLSGIAHHALNGATVGEALGVLPLHPSSFNQPLPETKGGIESLIPWLHNETEALKQAS
LLVRFNRPLLDEQKGNLPHMFWETEFLGPAGSDLHAAEGKFRATMLAISEEIRTRQFDEDGLSQGMPFIWRSIDP
RKIPYYLCV*
Coding >Pro_DTO070G2_2|g3977.t1
ATGACACTCTTCCCTATTTATAAGCTTTTGCTATCATTCCTCTATATTGGCAATGCTGTTGCTTGGCCAATTATT
TCCGTTCAGTCGGTTCTGAAACCTTTCGCTGCACTTCCCGACGACAATGGTCCTAAGTACAGCCTTCCAATGTTT
GACACCAGGTCCTGGGAAAGAGTAGACGAGATTCGTCTAGCTCGAGCAGGATATATCTATGGGCCCCCTTTACTC
GGAAACACATCCTTCTTCCCTACCGGGGTTCTGGGAGAAGCAATGGTAGCCCGAGACAGGGTTGCGTGGTTCAAA
GATGTGGAATATGTCACCAACAACGTCTACCTTGAGTTGGACAAGGCCGCTGCAGCACTGATTAAGGTGGGGGGC
ATACAATCACTCTCTAGCTATGAGATTCTTTACAAAGATCAATGGGCCTCCTCACTCCCGGACGGTGTATCCCCC
GGGATGCTGACCAACTGGACCCAAGATCTGCTTTTCTCCATGGAGAGGCTTTCTACTAATCCCTACGTGGTTCGA
CGCCTACATCCCAGAATTGGCAGTCTCCCTTTTCCAGTAGAAGATGGGGTGGTGCAACACCTGGCTGAGGGTCGA
ACACTGGCGGATCTACACCAGGAAGGACGTCTCTTCTATGCTGACCATTCCTATCAAGCCCCTTACCCCAAGACT
CCTGGGCGCTGGACAGCCGCTTGTACCGCGTATTTCTATATCCATCCTGGATCTGGCGATTTCCTTCCATTGGCT
ATCAAGACTAACATGGGGAAAAACCTTACATATACGCCACGGGACGACGCAAATGACTGGCTTTTCGCCAAAATG
GCCTTTGGCATGAACGATCTCTTCCATTCCCAGCTATACCATCTAGCAAATACACATGATGTCGCTGAGCCCGTG
CACCAGGCTGCCTTGCGAACCATGAGCTCGCGGCATCCTGTCCGTGGATACCTTGACCGCTTAATGTATCAGGCA
TATGCGGTTCGACCCATTGGTGAGGAATTCCTTTTCAATGAAGGCGGTTTCTACGACAGCTCCTTCGCGGTTCCA
AACTGGGCCGGCAAGAAGTTCGCAACAGACGCCTATTGGGAGCACGCGGGTCACTTCCGGTCCACGAATTTTTAT
CGGGATTTCGCAGACCGTGGTCTTCTAGATTGCGCGTATGGGCCTCCGCTCCGCTCCTTCCCATTCTATGAGACT
GTGGCACCCATGGTGCAAGCCATCGAAGACTTCACTCGTTCTTTCGTGGAATATTCCTACCCCAAGAGCAGTCTG
ATGGGCAGCGACCACGAACTACAAGCCTGGATCATGGAGGCCACCAGTGAGGCTCAAGTCATTGACTTTTTCCCT
GCCCCATTATTCGCGCGCGAGGATCTTGTCTCGATTCTCTCCCACATGGCATTCCTCTCTGGGATTGCGCATCAT
GCACTCAATGGTGCGACTGTCGGGGAGGCCCTGGGTGTGCTTCCGTTGCATCCCTCCTCCTTCAACCAGCCACTT
CCTGAGACTAAAGGGGGCATCGAATCGCTGATCCCGTGGCTGCATAACGAGACCGAGGCACTGAAGCAAGCTTCG
CTCCTCGTCAGGTTCAACCGACCATTGTTGGATGAGCAGAAAGGAAACCTTCCGCATATGTTCTGGGAGACCGAA
TTCTTAGGCCCGGCTGGAAGCGATCTTCATGCTGCCGAGGGGAAGTTTCGGGCGACGATGTTAGCTATCAGTGAA
GAAATCCGGACAAGGCAATTCGACGAGGATGGTTTATCGCAGGGTATGCCTTTTATCTGGCGTTCGATTGATCCG
AGGAAGATTCCTTACTACTTGTGTGTGTAG
Transcript >Pro_DTO070G2_2|g3977.t1
ATGACACTCTTCCCTATTTATAAGCTTTTGCTATCATTCCTCTATATTGGCAATGCTGTTGCTTGGCCAATTATT
TCCGTTCAGTCGGTTCTGAAACCTTTCGCTGCACTTCCCGACGACAATGGTCCTAAGTACAGCCTTCCAATGTTT
GACACCAGGTCCTGGGAAAGAGTAGACGAGATTCGTCTAGCTCGAGCAGGATATATCTATGGGCCCCCTTTACTC
GGAAACACATCCTTCTTCCCTACCGGGGTTCTGGGAGAAGCAATGGTAGCCCGAGACAGGGTTGCGTGGTTCAAA
GATGTGGAATATGTCACCAACAACGTCTACCTTGAGTTGGACAAGGCCGCTGCAGCACTGATTAAGGTGGGGGGC
ATACAATCACTCTCTAGCTATGAGATTCTTTACAAAGATCAATGGGCCTCCTCACTCCCGGACGGTGTATCCCCC
GGGATGCTGACCAACTGGACCCAAGATCTGCTTTTCTCCATGGAGAGGCTTTCTACTAATCCCTACGTGGTTCGA
CGCCTACATCCCAGAATTGGCAGTCTCCCTTTTCCAGTAGAAGATGGGGTGGTGCAACACCTGGCTGAGGGTCGA
ACACTGGCGGATCTACACCAGGAAGGACGTCTCTTCTATGCTGACCATTCCTATCAAGCCCCTTACCCCAAGACT
CCTGGGCGCTGGACAGCCGCTTGTACCGCGTATTTCTATATCCATCCTGGATCTGGCGATTTCCTTCCATTGGCT
ATCAAGACTAACATGGGGAAAAACCTTACATATACGCCACGGGACGACGCAAATGACTGGCTTTTCGCCAAAATG
GCCTTTGGCATGAACGATCTCTTCCATTCCCAGCTATACCATCTAGCAAATACACATGATGTCGCTGAGCCCGTG
CACCAGGCTGCCTTGCGAACCATGAGCTCGCGGCATCCTGTCCGTGGATACCTTGACCGCTTAATGTATCAGGCA
TATGCGGTTCGACCCATTGGTGAGGAATTCCTTTTCAATGAAGGCGGTTTCTACGACAGCTCCTTCGCGGTTCCA
AACTGGGCCGGCAAGAAGTTCGCAACAGACGCCTATTGGGAGCACGCGGGTCACTTCCGGTCCACGAATTTTTAT
CGGGATTTCGCAGACCGTGGTCTTCTAGATTGCGCGTATGGGCCTCCGCTCCGCTCCTTCCCATTCTATGAGACT
GTGGCACCCATGGTGCAAGCCATCGAAGACTTCACTCGTTCTTTCGTGGAATATTCCTACCCCAAGAGCAGTCTG
ATGGGCAGCGACCACGAACTACAAGCCTGGATCATGGAGGCCACCAGTGAGGCTCAAGTCATTGACTTTTTCCCT
GCCCCATTATTCGCGCGCGAGGATCTTGTCTCGATTCTCTCCCACATGGCATTCCTCTCTGGGATTGCGCATCAT
GCACTCAATGGTGCGACTGTCGGGGAGGCCCTGGGTGTGCTTCCGTTGCATCCCTCCTCCTTCAACCAGCCACTT
CCTGAGACTAAAGGGGGCATCGAATCGCTGATCCCGTGGCTGCATAACGAGACCGAGGCACTGAAGCAAGCTTCG
CTCCTCGTCAGGTTCAACCGACCATTGTTGGATGAGCAGAAAGGAAACCTTCCGCATATGTTCTGGGAGACCGAA
TTCTTAGGCCCGGCTGGAAGCGATCTTCATGCTGCCGAGGGGAAGTTTCGGGCGACGATGTTAGCTATCAGTGAA
GAAATCCGGACAAGGCAATTCGACGAGGATGGTTTATCGCAGGGTATGCCTTTTATCTGGCGTTCGATTGATCCG
AGGAAGATTCCTTACTACTTGTGTGTGTAG
Gene >Pro_DTO070G2_2|g3977.t1
ATGACACTCTTCCCTATTTATAAGCTTTTGCTATCATTCCTCTATATTGGCAATGCTGTTGCTTGGCCAATTATT
TCCGTTCAGTCGGTTCTGAAACCTTTCGCTGCACTTCCCGACGACAATGGTCCTAAGTACAGCCTTCCAATGTTT
GACACCAGGTCCTGGGAAAGAGTAGACGAGATTCGTCTAGCTCGAGCAGGATATATCTATGGGCCCCCTTTACTC
GGAAACACATCCTTCTTCCCTACCGGGGTTCTGGGAGAAGCAATGGTAGCCCGAGACAGGGTTGCGTGGTTCAAA
GATGTGGAATATGTCACCAACAACGTCTACCTTGAGTTGGACAAGGCCGCTGCAGCACTGATTAAGGTATACCGG
CAGAAGTCCCTTTGTCTAAAATGGGCCCTAGCTAATCATATAAGGTGGGGGGCATACAATCACTCTCTAGCTATG
AGATTCTTTACAAAGATCAATGGGCCTCCTCACTCCCGGACGGTGTATCCCCCGGGATGCTGACCAACTGGACCC
AAGATCTGCTTTTCTCCATGGAGAGGCTTTCTACTAATCCCTACGTGGTTCGACGCCTACATCCCAGAATTGGCA
GTCTCCCTTTTCCAGTAGAAGATGGGGTGGTGCAACACCTGGCTGAGGGTCGAACACTGGCGGATCTACACCAGG
AAGGACGTCTCTTCTATGCTGACCATTCCTATCAAGCCCCTTACCCCAAGACTCCTGGGCGCTGGACAGCCGCTT
GTACCGCGTATTTCTATATCCATCCTGGATCTGGCGATTTCCTTCCATTGGCTATCAAGACTAACATGGGGAAAA
ACCTTACATATACGCCACGGGACGACGCAAATGACTGGCTTTTCGCCAAAATGGCCTTTGGCATGAACGATCTCT
TCCATTCCCAGCTATACCATCTAGCAAATACACATGATGTCGCTGAGCCCGTGCACCAGGCTGCCTTGCGAACCA
TGAGCTCGCGGCATCCTGTCCGTGGATACCTTGACCGCTGTATGTTGCTCTCCCTTCGGCGTTTCAAAATTCAAC
GCAGCTAATTATTCAAAGTAATGTATCAGGCATATGCGGTTCGACCCATTGGTGAGGAATTCCTTTTCAATGAAG
GCGGTTTCTACGACAGCTCCTTCGCGGTTCCAAACTGGGCCGGCAAGAAGTTCGCAACAGACGCCTATTGGGAGC
ACGCGGGTCACTTCCGGTCCACGAATTTTTATCGGGATTTCGCAGACCGTGGTCTTCTAGATTGCGCGTATGGGC
CTCCGCTCCGCTCCTTCCCATTCTATGAGACTGTGGCACCCATGGTGCAAGCCATCGAAGACTTCACTCGTTCTT
TCGTGGAATATTCCTACCCCAAGAGCAGTCTGATGGGCAGCGACCACGAACTACAAGCCTGGATCATGGAGGCCA
CCAGTGAGGCTCAAGTCATTGACTTTTTCCCTGCCCCATTATTCGCGCGCGAGGATCTTGTCTCGATTCTCTCCC
ACATGGCATTCCTCTCTGGGATTGCGCATCATGCACTCAATGGTGCGACTGTCGGGGAGGCCCTGGGTGTGCTTC
CGTTGCATCCCTCCTCCTTCAACCAGCCACTTCCTGAGACTAAAGGGGGCATCGAATCGCTGATCCCGTGGCTGC
ATAACGAGACCGAGGCACTGAAGCAAGCTTCGCTCCTCGTCAGGTTCAACCGACCATTGTTGGATGAGCAGAAAG
GAAACCTTCCGCATATGTTCTGGGAGACCGAATTCTTAGGCCCGGCTGGAAGCGATCTTCATGCTGCCGAGGGGA
AGTTTCGGGCGACGATGTTAGCTATCAGTGAAGAAATCCGGACAAGGCAATTCGACGAGGATGGTTTATCGCAGG
GTATGCCTTTTATCTGGCGTTCGATTGATCCGAGGAAGATTCCTTACTACTTGTGTGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail