Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g3851.t1
Gene name
Locationscaffold_04:140480..143508
Strand+
Gene length (bp)3028
Transcript length (bp)2688
Coding sequence length (bp)2688
Protein length (aa) 896

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17652 Glyco_hydro81C Glycosyl hydrolase family 81 C-terminal domain 8.0E-169 534 885
PF03639 Glyco_hydro_81 Glycosyl hydrolase family 81 N-terminal domain 7.8E-117 201 525

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g3851.t1
MDSRLKWKATAVLTWLLATEKAYCLPHVGNEVEATLQNTATEPARAFETQYPPSNSEDRLLIPESHPVYRVALEQ
DGHSSQQPFPQFDIIRFVDGLEDLLGSGGNTPAPTLTATGQSTGTGKSHPIQATTSAKQPENPAPIHTAGSVTYS
PQAGPSTTVAHEPVHILSSSSVTSKTMPSQDIFQPVATGPVPANIKSRDDHPVQNQHANTTNPIATNKFYAGLFL
GSQTNATFTQPYSLAWSKGGGSLKSWGMAVSHVQPHMLAYGPPNSKIPGNPVQYYINPIGLQSLIFSATELNQSS
IMNVNQPKAFSAHAVIKPSEGSAKQIVFPVVQGMGYATAVYSDLQPVIESGVFFRKVVSAGSPRSGIFKYQVYLE
DDMTWLLYATPADGKDPEFKLVSNSRLRGPQGFSGTIQVAKNPAGKSGEKFYDNSSGVYPVAGKISGSVTDDVGT
YTLSWKKAGKDVTGTPLIMFALPHHVQSFDGATKSRITDINLRTTTKGNSTAVIGESWTMVEQSLPIDIGFAPWS
TTQGSSNELSASAQHAILQAAPQELKQNISGQTDLNSMYYSGKALSKFATLVYTVNQLGNSSDLATDAFQKLKKS
FDLFVQNKQQYPLAYDSVWKGVVSTAGYNGDLNQDFGNTAYNDHHFHYGYFIQAAAIIGSLDPSWLAANKEWVNM
LVRDAGNSVPNDPYFPFSRSFDWYNGHSWAKGLFESFDGKDQESTSEDTMFAYAIKMWGQTTGDASMEARGNIML
SILGRSLNNYFLMEDDNVNQPANFTANRVTGILFENKVDHTTYFGANLEYVQGIHMLPLMPHSPFTRRKEFVRQE
WQAMFAENASTPASKVEGGWKGVLYANLALIDPKSSWDFFAQSNFDYSWIDGGATRTWYLAFIAGLGGAP*
Coding >Pro_DTO070G2_2|g3851.t1
ATGGACTCACGCTTGAAATGGAAGGCTACAGCCGTGCTGACTTGGCTTTTAGCTACAGAAAAAGCCTACTGTCTC
CCACACGTGGGAAATGAGGTAGAAGCTACTCTGCAAAACACAGCTACCGAACCTGCACGTGCCTTTGAGACTCAG
TATCCACCTTCAAACAGTGAAGACAGGCTGCTTATTCCCGAGTCCCACCCTGTGTATCGAGTAGCTTTGGAACAG
GACGGTCATTCATCGCAGCAGCCTTTTCCACAGTTTGACATTATCCGATTTGTTGACGGCTTGGAAGATTTGTTG
GGCTCAGGTGGTAATACTCCTGCACCAACACTGACTGCGACAGGACAGTCTACTGGTACAGGAAAATCGCATCCT
ATTCAAGCTACGACTTCAGCAAAACAGCCTGAAAACCCAGCGCCAATTCATACAGCTGGATCTGTGACCTACTCA
CCGCAGGCTGGGCCAAGTACTACTGTGGCACATGAGCCCGTTCACATACTTTCTTCATCCTCGGTTACATCAAAA
ACCATGCCTAGCCAAGATATCTTCCAGCCGGTTGCGACTGGTCCTGTCCCTGCTAATATCAAGTCCCGAGATGAT
CACCCTGTGCAGAACCAGCACGCCAATACTACCAACCCTATTGCGACGAATAAGTTCTACGCAGGCCTTTTCTTG
GGCTCTCAGACCAATGCTACTTTCACTCAACCCTACTCTCTGGCATGGTCCAAGGGAGGTGGCTCCCTGAAGAGT
TGGGGTATGGCTGTCTCCCATGTCCAGCCTCATATGCTTGCATACGGACCACCGAACAGCAAGATCCCCGGAAAC
CCAGTACAATACTACATCAACCCAATCGGCCTTCAATCTCTGATCTTCTCTGCAACCGAGCTTAACCAGTCTTCC
ATCATGAACGTCAATCAGCCAAAGGCTTTCTCGGCCCACGCTGTGATCAAGCCCTCTGAAGGCTCGGCTAAGCAG
ATTGTCTTCCCCGTTGTGCAAGGCATGGGCTACGCAACAGCTGTGTACAGTGATCTGCAGCCGGTGATTGAAAGT
GGCGTTTTCTTCCGTAAGGTCGTCAGCGCTGGTTCGCCTAGGTCCGGCATCTTCAAGTACCAGGTTTACCTCGAG
GATGACATGACCTGGCTTCTCTATGCCACTCCGGCTGATGGCAAGGATCCGGAGTTCAAGCTAGTCTCAAATTCC
CGTCTTCGCGGGCCCCAGGGCTTTTCTGGTACTATTCAAGTTGCCAAGAACCCCGCGGGCAAGTCTGGCGAGAAA
TTCTATGATAACTCGTCTGGTGTATACCCAGTGGCAGGAAAAATCTCTGGTTCTGTCACAGATGATGTAGGCACC
TACACGCTCTCTTGGAAGAAGGCCGGAAAGGATGTCACCGGCACTCCTCTGATCATGTTCGCCCTACCCCATCAC
GTCCAATCCTTCGATGGTGCCACCAAGAGCCGTATCACTGATATCAACCTTCGCACCACAACAAAGGGCAACTCC
ACTGCAGTCATTGGAGAAAGCTGGACTATGGTCGAACAAAGCCTCCCCATTGATATTGGATTCGCTCCGTGGTCA
ACCACCCAGGGCAGTTCTAACGAGCTCTCAGCCTCAGCTCAGCATGCCATTCTCCAGGCTGCTCCCCAGGAGCTC
AAGCAGAACATTTCAGGCCAGACGGACCTTAACAGCATGTACTACAGCGGCAAGGCGTTGAGCAAGTTCGCAACG
CTAGTGTATACTGTCAACCAGCTTGGCAACAGTTCTGATCTAGCAACAGATGCCTTCCAAAAGCTAAAGAAGTCT
TTCGATCTATTCGTGCAAAACAAGCAGCAATACCCGCTCGCCTACGATTCCGTCTGGAAGGGCGTTGTCTCGACC
GCCGGCTACAATGGCGACCTCAACCAGGATTTCGGAAACACCGCATACAACGATCACCATTTCCACTACGGCTAC
TTCATCCAAGCTGCCGCCATCATTGGCTCTCTTGATCCCAGCTGGCTAGCCGCGAACAAGGAGTGGGTCAACATG
CTTGTTCGTGATGCTGGTAACTCTGTTCCAAATGATCCTTACTTCCCATTCTCGCGCTCGTTTGATTGGTATAAC
GGTCACTCATGGGCGAAGGGTTTGTTCGAGTCTTTCGATGGCAAGGATCAAGAATCTACCTCGGAAGATACCATG
TTCGCGTATGCGATCAAGATGTGGGGGCAGACGACCGGCGATGCTAGCATGGAAGCTCGTGGCAATATTATGCTG
AGCATCCTGGGTCGGTCTCTCAATAATTACTTCCTGATGGAGGATGACAATGTCAACCAGCCTGCGAACTTCACT
GCGAACAGGGTAACTGGAATTCTATTCGAGAATAAGGTTGATCACACCACCTATTTCGGTGCCAACCTCGAATAC
GTCCAAGGTATTCACATGCTACCGCTCATGCCGCACAGTCCCTTCACACGCCGAAAGGAGTTTGTGCGCCAGGAG
TGGCAGGCAATGTTCGCTGAAAACGCCTCTACTCCGGCCTCCAAGGTTGAGGGCGGATGGAAGGGTGTGCTCTAC
GCCAACCTGGCCCTCATCGATCCCAAATCGTCGTGGGACTTCTTTGCCCAGTCGAATTTCGACTACAGCTGGATT
GATGGTGGTGCTACGCGTACTTGGTACCTGGCATTTATTGCTGGTCTGGGGGGTGCTCCTTAA
Transcript >Pro_DTO070G2_2|g3851.t1
ATGGACTCACGCTTGAAATGGAAGGCTACAGCCGTGCTGACTTGGCTTTTAGCTACAGAAAAAGCCTACTGTCTC
CCACACGTGGGAAATGAGGTAGAAGCTACTCTGCAAAACACAGCTACCGAACCTGCACGTGCCTTTGAGACTCAG
TATCCACCTTCAAACAGTGAAGACAGGCTGCTTATTCCCGAGTCCCACCCTGTGTATCGAGTAGCTTTGGAACAG
GACGGTCATTCATCGCAGCAGCCTTTTCCACAGTTTGACATTATCCGATTTGTTGACGGCTTGGAAGATTTGTTG
GGCTCAGGTGGTAATACTCCTGCACCAACACTGACTGCGACAGGACAGTCTACTGGTACAGGAAAATCGCATCCT
ATTCAAGCTACGACTTCAGCAAAACAGCCTGAAAACCCAGCGCCAATTCATACAGCTGGATCTGTGACCTACTCA
CCGCAGGCTGGGCCAAGTACTACTGTGGCACATGAGCCCGTTCACATACTTTCTTCATCCTCGGTTACATCAAAA
ACCATGCCTAGCCAAGATATCTTCCAGCCGGTTGCGACTGGTCCTGTCCCTGCTAATATCAAGTCCCGAGATGAT
CACCCTGTGCAGAACCAGCACGCCAATACTACCAACCCTATTGCGACGAATAAGTTCTACGCAGGCCTTTTCTTG
GGCTCTCAGACCAATGCTACTTTCACTCAACCCTACTCTCTGGCATGGTCCAAGGGAGGTGGCTCCCTGAAGAGT
TGGGGTATGGCTGTCTCCCATGTCCAGCCTCATATGCTTGCATACGGACCACCGAACAGCAAGATCCCCGGAAAC
CCAGTACAATACTACATCAACCCAATCGGCCTTCAATCTCTGATCTTCTCTGCAACCGAGCTTAACCAGTCTTCC
ATCATGAACGTCAATCAGCCAAAGGCTTTCTCGGCCCACGCTGTGATCAAGCCCTCTGAAGGCTCGGCTAAGCAG
ATTGTCTTCCCCGTTGTGCAAGGCATGGGCTACGCAACAGCTGTGTACAGTGATCTGCAGCCGGTGATTGAAAGT
GGCGTTTTCTTCCGTAAGGTCGTCAGCGCTGGTTCGCCTAGGTCCGGCATCTTCAAGTACCAGGTTTACCTCGAG
GATGACATGACCTGGCTTCTCTATGCCACTCCGGCTGATGGCAAGGATCCGGAGTTCAAGCTAGTCTCAAATTCC
CGTCTTCGCGGGCCCCAGGGCTTTTCTGGTACTATTCAAGTTGCCAAGAACCCCGCGGGCAAGTCTGGCGAGAAA
TTCTATGATAACTCGTCTGGTGTATACCCAGTGGCAGGAAAAATCTCTGGTTCTGTCACAGATGATGTAGGCACC
TACACGCTCTCTTGGAAGAAGGCCGGAAAGGATGTCACCGGCACTCCTCTGATCATGTTCGCCCTACCCCATCAC
GTCCAATCCTTCGATGGTGCCACCAAGAGCCGTATCACTGATATCAACCTTCGCACCACAACAAAGGGCAACTCC
ACTGCAGTCATTGGAGAAAGCTGGACTATGGTCGAACAAAGCCTCCCCATTGATATTGGATTCGCTCCGTGGTCA
ACCACCCAGGGCAGTTCTAACGAGCTCTCAGCCTCAGCTCAGCATGCCATTCTCCAGGCTGCTCCCCAGGAGCTC
AAGCAGAACATTTCAGGCCAGACGGACCTTAACAGCATGTACTACAGCGGCAAGGCGTTGAGCAAGTTCGCAACG
CTAGTGTATACTGTCAACCAGCTTGGCAACAGTTCTGATCTAGCAACAGATGCCTTCCAAAAGCTAAAGAAGTCT
TTCGATCTATTCGTGCAAAACAAGCAGCAATACCCGCTCGCCTACGATTCCGTCTGGAAGGGCGTTGTCTCGACC
GCCGGCTACAATGGCGACCTCAACCAGGATTTCGGAAACACCGCATACAACGATCACCATTTCCACTACGGCTAC
TTCATCCAAGCTGCCGCCATCATTGGCTCTCTTGATCCCAGCTGGCTAGCCGCGAACAAGGAGTGGGTCAACATG
CTTGTTCGTGATGCTGGTAACTCTGTTCCAAATGATCCTTACTTCCCATTCTCGCGCTCGTTTGATTGGTATAAC
GGTCACTCATGGGCGAAGGGTTTGTTCGAGTCTTTCGATGGCAAGGATCAAGAATCTACCTCGGAAGATACCATG
TTCGCGTATGCGATCAAGATGTGGGGGCAGACGACCGGCGATGCTAGCATGGAAGCTCGTGGCAATATTATGCTG
AGCATCCTGGGTCGGTCTCTCAATAATTACTTCCTGATGGAGGATGACAATGTCAACCAGCCTGCGAACTTCACT
GCGAACAGGGTAACTGGAATTCTATTCGAGAATAAGGTTGATCACACCACCTATTTCGGTGCCAACCTCGAATAC
GTCCAAGGTATTCACATGCTACCGCTCATGCCGCACAGTCCCTTCACACGCCGAAAGGAGTTTGTGCGCCAGGAG
TGGCAGGCAATGTTCGCTGAAAACGCCTCTACTCCGGCCTCCAAGGTTGAGGGCGGATGGAAGGGTGTGCTCTAC
GCCAACCTGGCCCTCATCGATCCCAAATCGTCGTGGGACTTCTTTGCCCAGTCGAATTTCGACTACAGCTGGATT
GATGGTGGTGCTACGCGTACTTGGTACCTGGCATTTATTGCTGGTCTGGGGGGTGCTCCTTAA
Gene >Pro_DTO070G2_2|g3851.t1
ATGGACTCACGCTTGAAATGGAAGGCTACAGCCGTGCTGACTTGGCTTTTAGCTACAGAAAAAGCCTACTGTCTC
CCACACGTGGGAAATGAGGTAGAAGCTACTCTGCAAAACACAGCTACCGAACCTGCACGTGCCTTTGAGACTCAG
TATCCACCTTCAAACAGTGAAGACAGGCTGCTTATTCCCGAGTCCCACCCTGTACGTCTCAGAGAAATGTGCTGC
ATAGTATATGGTATGGTATTGACATTTTGGACTAGGTGTATCGAGTAGCTTTGGAACAGGACGGTCATTCATCGC
AGCAGCCTTTTCCACAGTTTGACATTATCCGATTTGTTGACGGCTTGGAAGATTTGTTGGGCTCAGGTGGTAATA
CTCCTGCACCAACACTGACTGCGACAGGACAGTCTACTGGTACAGGAAAATCGCATCCTATTCAAGCTACGACTT
CAGCAAAACAGCCTGAAAACCCAGCGCCAATTCATACAGCTGGATCTGTGACCTACTCACCGCAGGCTGGGCCAA
GTACTACTGTGGCACATGGTATGATTGACCATGAATTATAGCAACTTCAAATTCTAATGCTTAGTAGAGCCCGTT
CACATACTTTCTTCATCCTCGGTTACATCAAAAACCATGCCTAGCCAAGATATCTTCCAGCCGGTTGCGACTGGT
CCTGTCCCTGCTAATATCAAGTCCCGAGATGATCACCCTGTGCAGAACCAGCACGTAAGATTATCCCAAATGTGA
GCACGAATCAAACATTCTAATGTTGTGGTATAGGCCAATACTACCAACCCTATTGCGACGAATAAGTTCTACGCA
GGCCTTTTCTTGGGCTCTCAGACCAATGCTACTTTCACTCAACCCTACTCTCTGGCATGGTCCAAGGGAGGTGGC
TCCCTGAAGAGTTGGGGTATGGCTGTCTCCCATGTCCAGCCTCATATGCTTGCATACGGACCACCGAACAGCAAG
ATCCCCGGAAACCCAGTACAATACTACATCAACCCAATCGGCCTTCAATCTCTGATCTTCTCTGCAACCGAGCTT
AACCAGTCTTCCATCATGAACGTCAATCAGCCAAAGGCTTTCTCGGCCCACGCTGTGATCAAGCCCTCTGAAGGC
TCGGCTAAGCAGATTGTCTTCCCCGTTGTGCAAGGCATGGGCTACGCAACAGCTGTGTACAGTGATCTGCAGCCG
GTGATTGAAAGTGGCGTTTTCTTCCGTAAGGTCGTCAGCGCTGGTTCGCCTAGGTCCGGCATCTTCAAGTACCAG
GTTTACCTCGAGGATGACATGACCTGGCTTCTCTATGCCACTCCGGCTGATGGCAAGGATCCGGAGTTCAAGCTA
GTCTCAAATTCCCGTCTTCGCGGGCCCCAGGGCTTTTCTGGTACTATTCAAGTTGCCAAGAACCCCGCGGGCAAG
TCTGGCGAGAAATTCTATGATAACTCGTCTGGTGTATACCCAGTGGCAGGAAAAATCTCTGGTTCTGTCACAGAT
GATGTAGGCACCTACACGCTCTCTTGGAAGAAGGCCGGAAAGGATGTCACCGGCACTCCTCTGATCATGTTCGCC
CTACCCCATCACGTCCAATCCTTCGATGGTGCCACCAAGAGCCGTATCACTGATATCAACCTTCGCACCACAACA
AAGGGCAACTCCACTGCAGTCATTGGAGAAAGCTGGACTATGGTCGAACAAAGCCTCCCCATTGATATTGGATTC
GCTCCGTGGTCAACCACCCAGGGCAGTTCTAACGAGCTCTCAGCCTCAGCTCAGCATGCCATTCTCCAGGCTGCT
CCCCAGGAGCTCAAGCAGAACATTTCAGGCCAGACGGACCTTAACAGCATGTACTACAGCGGCAAGGCGTTGAGC
AAGTTCGCAACGCTAGTGTATACTGTCAACCAGCTTGGCAACAGTTCTGATCTAGCAACAGATGCCTTCCAAAAG
CTAAAGAAGTCTTTCGATCTATTCGTGCAAAACAAGCAGCAATACCCGCTCGCCTACGATTCCGTCTGGAAGGGC
GTTGTCTCGACCGCCGGCTACAATGGCGACCTCAACCAGGATTTCGGAAACACCGCATACAACGATCACCATTTC
CACTACGGCTACTTCATCCAAGCTGCCGCCATCATTGGCTCTCTTGATCCCAGCTGGCTAGCCGCGAACAAGGAG
TGGGTCAACATGCTTGTTCGTGATGCTGGTAACTCTGTTCCAAATGATCCTTACTTCCCATTCTCGCGCTCGTTT
GATTGGTATAACGGTCACTCATGGGCGAAGGGTTTGTTCGAGTCTTTCGATGGCAAGGATCAAGAATCTACCTCG
GAAGATACCATGTTCGCGTATGCGATCAAGATGTGGGGGCAGACGACCGGCGATGCTAGCATGGAAGCTCGTGGC
AATATTATGCTGAGCATCCTGGGTCGGTCTCTCAATAATTACTTCCTGATGGAGGATGACAATGTCAACCAGCCT
GCGAACTTCACTGCGAACAGGGTAACTGGAATTGTAAGTACCACCATTCTCTTTCCATGTCTAGCCCAAACTCGA
CATTAACAGACCAAAACAAACAGCTATTCGAGAATAAGGTTGATCACACCACCTATTTCGGTGCCAACCTCGAAT
ACGTCCAAGGGTATGTATACCACCGTCCCGCTGTTTTTTTTCACTCCGAACTATTGCTCACAAGTATTAGTATTC
ACATGCTACCGCTCATGCCGCACAGTCCCTTCACACGCCGAAAGGAGTTTGTGCGCCAGGAGTGGCAGGCAATGT
TCGCTGAAAACGCCTCTACTCCGGCCTCCAAGGTTGAGGGCGGATGGAAGGGTGTGCTCTACGCCAACCTGGCCC
TCATCGATCCCAAATCGTCGTGGGACTTCTTTGCCCAGTCGAATTTCGACTACAGCTGGATTGATGGTGGTGCTA
CGCGTACTTGGTACCTGGCATTTATTGCTGGTGAGTCTCTTGAATGGAGTATGATGTCTTTTCATACTAACGAAA
CATATTAGGTCTGGGGGGTGCTCCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail