Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g3705.t1
Gene name
Locationscaffold_03:2370273..2372081
Strand-
Gene length (bp)1808
Transcript length (bp)1755
Coding sequence length (bp)1755
Protein length (aa) 585

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01425 Amidase Amidase 4.1E-68 83 385

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g3705.t1
MAPLIQTLVSGLALVSSVIAQESDCLVDSQILVDPYLYDFPRLGGNGAAQFAMRPCHGFKLEEATIDQIQAELKN
GTFTGVQLLECYMDRVHQTQPYLNAILQVNPDAFTIAKKLDEERAAGTVRGPLHGIPFIVKDNIASKDRLETTAG
SWALLGNVVPRDSHVVHGMRKAGALLLGKAALSEWADMRSNNYSEGFSARGGQCRSAYNFTVNPGGSSTGSGVAV
AANLVPIALGTETDGSVINPAQRNSIVGIKPTVGLTSRAGVIPESTHQDTVGTFGKTVRDAVYALDAIYGIDPRD
NYTSAQEGLTPVGGYTQFLSNQTALKGAVFGIPWKSFWALGDADQIAQLLDLVKLIESAGATVINGTELPHYKEI
VSPDGWNWDYGTTRGYSNESSYSYIKVDFYNNLRDYLSEVENTNVRSVEDLVQYNIDNYGSEGGLPGIHPAFGSG
QDGLIASLESKGIMNETYFQALEFCRRTTREEGIDAALKHGNRTLDGLLVPPDVAQSVEIAAQAGYPVITVPGGV
SDVSGMPFGLAIMNTAFSEATLIKYASAIEDLKKNHGAKYDRALPEWRGYLQRPLPVAF*
Coding >Pro_DTO070G2_2|g3705.t1
ATGGCACCTCTAATTCAAACATTGGTGAGCGGTCTCGCCTTGGTGAGCTCCGTTATTGCTCAAGAGTCCGACTGT
TTGGTCGACTCCCAGATCCTCGTCGATCCCTACCTTTATGACTTCCCTCGCCTGGGCGGTAATGGCGCTGCACAG
TTCGCTATGCGCCCCTGTCACGGTTTCAAGCTGGAGGAGGCTACGATCGATCAGATCCAAGCCGAGCTGAAGAAT
GGCACTTTCACTGGCGTCCAGTTGCTGGAGTGCTACATGGACCGTGTCCACCAGACCCAGCCTTATTTGAATGCT
ATCCTGCAAGTGAACCCGGATGCTTTCACCATTGCCAAGAAGCTCGATGAGGAGCGTGCTGCAGGCACTGTCCGT
GGTCCTCTTCACGGTATTCCCTTCATTGTCAAGGACAACATCGCCAGTAAGGATCGTTTGGAGACCACTGCCGGC
AGCTGGGCTCTTCTCGGTAATGTCGTGCCCCGTGATTCTCATGTCGTTCACGGCATGCGCAAGGCCGGTGCTCTG
CTTCTCGGCAAGGCTGCTCTGAGTGAGTGGGCCGATATGCGCTCCAACAACTACTCCGAAGGCTTCAGTGCCCGT
GGTGGTCAGTGCCGCAGTGCTTACAACTTCACCGTTAACCCCGGTGGTAGCAGCACTGGCTCTGGTGTTGCTGTC
GCTGCTAACCTGGTGCCTATTGCTCTTGGAACCGAGACCGATGGCTCTGTCATCAACCCTGCTCAGCGCAACTCT
ATTGTTGGCATCAAGCCCACCGTCGGTCTGACCTCGCGTGCTGGTGTCATCCCGGAATCGACCCACCAGGACACC
GTCGGCACCTTCGGCAAGACCGTCCGTGATGCTGTTTACGCCCTCGATGCCATCTACGGCATTGACCCCCGCGAC
AACTACACCTCCGCTCAGGAGGGTCTCACCCCCGTCGGTGGATACACCCAGTTCCTGAGCAACCAGACCGCTCTT
AAGGGCGCCGTCTTCGGTATTCCCTGGAAGTCCTTCTGGGCCCTCGGCGACGCCGACCAAATCGCCCAGCTCCTT
GATCTGGTCAAGCTGATCGAGTCCGCTGGCGCCACCGTCATCAACGGCACCGAGCTGCCCCACTATAAGGAGATT
GTCTCGCCCGACGGCTGGAACTGGGACTATGGCACCACCCGCGGCTACTCCAACGAGTCCTCTTACTCCTACATC
AAGGTTGACTTCTACAACAACCTGCGTGACTACCTGTCCGAGGTCGAGAACACTAACGTCCGCTCTGTCGAGGAC
CTCGTCCAGTACAACATCGATAACTACGGCTCCGAGGGTGGTCTGCCCGGTATCCACCCTGCCTTCGGCTCTGGC
CAGGACGGTCTCATCGCTTCCCTTGAGAGCAAGGGCATTATGAACGAGACATACTTCCAGGCTTTGGAGTTCTGC
CGGCGCACTACCCGTGAGGAGGGTATCGATGCTGCTTTGAAGCACGGCAACCGTACTCTCGACGGTCTCCTTGTG
CCTCCCGATGTCGCCCAGAGCGTTGAGATTGCCGCCCAGGCTGGATACCCCGTTATTACTGTTCCTGGTGGCGTC
AGCGATGTCTCGGGCATGCCCTTTGGCCTTGCTATCATGAACACTGCTTTCTCCGAGGCCACCTTGATCAAGTAC
GCCAGTGCTATCGAGGATCTGAAGAAGAACCACGGCGCCAAGTACGACCGTGCACTGCCTGAGTGGCGCGGCTAC
CTGCAGCGCCCTCTCCCCGTCGCTTTCTAG
Transcript >Pro_DTO070G2_2|g3705.t1
ATGGCACCTCTAATTCAAACATTGGTGAGCGGTCTCGCCTTGGTGAGCTCCGTTATTGCTCAAGAGTCCGACTGT
TTGGTCGACTCCCAGATCCTCGTCGATCCCTACCTTTATGACTTCCCTCGCCTGGGCGGTAATGGCGCTGCACAG
TTCGCTATGCGCCCCTGTCACGGTTTCAAGCTGGAGGAGGCTACGATCGATCAGATCCAAGCCGAGCTGAAGAAT
GGCACTTTCACTGGCGTCCAGTTGCTGGAGTGCTACATGGACCGTGTCCACCAGACCCAGCCTTATTTGAATGCT
ATCCTGCAAGTGAACCCGGATGCTTTCACCATTGCCAAGAAGCTCGATGAGGAGCGTGCTGCAGGCACTGTCCGT
GGTCCTCTTCACGGTATTCCCTTCATTGTCAAGGACAACATCGCCAGTAAGGATCGTTTGGAGACCACTGCCGGC
AGCTGGGCTCTTCTCGGTAATGTCGTGCCCCGTGATTCTCATGTCGTTCACGGCATGCGCAAGGCCGGTGCTCTG
CTTCTCGGCAAGGCTGCTCTGAGTGAGTGGGCCGATATGCGCTCCAACAACTACTCCGAAGGCTTCAGTGCCCGT
GGTGGTCAGTGCCGCAGTGCTTACAACTTCACCGTTAACCCCGGTGGTAGCAGCACTGGCTCTGGTGTTGCTGTC
GCTGCTAACCTGGTGCCTATTGCTCTTGGAACCGAGACCGATGGCTCTGTCATCAACCCTGCTCAGCGCAACTCT
ATTGTTGGCATCAAGCCCACCGTCGGTCTGACCTCGCGTGCTGGTGTCATCCCGGAATCGACCCACCAGGACACC
GTCGGCACCTTCGGCAAGACCGTCCGTGATGCTGTTTACGCCCTCGATGCCATCTACGGCATTGACCCCCGCGAC
AACTACACCTCCGCTCAGGAGGGTCTCACCCCCGTCGGTGGATACACCCAGTTCCTGAGCAACCAGACCGCTCTT
AAGGGCGCCGTCTTCGGTATTCCCTGGAAGTCCTTCTGGGCCCTCGGCGACGCCGACCAAATCGCCCAGCTCCTT
GATCTGGTCAAGCTGATCGAGTCCGCTGGCGCCACCGTCATCAACGGCACCGAGCTGCCCCACTATAAGGAGATT
GTCTCGCCCGACGGCTGGAACTGGGACTATGGCACCACCCGCGGCTACTCCAACGAGTCCTCTTACTCCTACATC
AAGGTTGACTTCTACAACAACCTGCGTGACTACCTGTCCGAGGTCGAGAACACTAACGTCCGCTCTGTCGAGGAC
CTCGTCCAGTACAACATCGATAACTACGGCTCCGAGGGTGGTCTGCCCGGTATCCACCCTGCCTTCGGCTCTGGC
CAGGACGGTCTCATCGCTTCCCTTGAGAGCAAGGGCATTATGAACGAGACATACTTCCAGGCTTTGGAGTTCTGC
CGGCGCACTACCCGTGAGGAGGGTATCGATGCTGCTTTGAAGCACGGCAACCGTACTCTCGACGGTCTCCTTGTG
CCTCCCGATGTCGCCCAGAGCGTTGAGATTGCCGCCCAGGCTGGATACCCCGTTATTACTGTTCCTGGTGGCGTC
AGCGATGTCTCGGGCATGCCCTTTGGCCTTGCTATCATGAACACTGCTTTCTCCGAGGCCACCTTGATCAAGTAC
GCCAGTGCTATCGAGGATCTGAAGAAGAACCACGGCGCCAAGTACGACCGTGCACTGCCTGAGTGGCGCGGCTAC
CTGCAGCGCCCTCTCCCCGTCGCTTTCTAG
Gene >Pro_DTO070G2_2|g3705.t1
ATGGCACCTCTAATTCAAACATTGGTGAGCGGTCTCGCCTTGGTGAGCTCCGTTATTGCTCAAGAGTCCGACTGT
TTGGTCGACTCCCAGATCCTCGTCGATCCCTACCTTTATGACTTCCCTCGCCTGGGCGGTAATGGCGCTGCACAG
TTCGCTATGCGCCCCTGTCACGGTTTCAAGCTGGAGGAGGCTACGATCGATCAGATCCAAGCCGAGCTGAAGAAT
GGCACTTTCACTGGCGTCCAGTTGCTGGAGTGCTACATGGACCGTGTCCACCAGACCCAGCCTTATTTGAAGTAT
GTTAGTTATGTTGAATCTCGTCAAAATTGTTGACTAACAGCCTTGCTAGTGCTATCCTGCAAGTGAACCCGGATG
CTTTCACCATTGCCAAGAAGCTCGATGAGGAGCGTGCTGCAGGCACTGTCCGTGGTCCTCTTCACGGTATTCCCT
TCATTGTCAAGGACAACATCGCCAGTAAGGATCGTTTGGAGACCACTGCCGGCAGCTGGGCTCTTCTCGGTAATG
TCGTGCCCCGTGATTCTCATGTCGTTCACGGCATGCGCAAGGCCGGTGCTCTGCTTCTCGGCAAGGCTGCTCTGA
GTGAGTGGGCCGATATGCGCTCCAACAACTACTCCGAAGGCTTCAGTGCCCGTGGTGGTCAGTGCCGCAGTGCTT
ACAACTTCACCGTTAACCCCGGTGGTAGCAGCACTGGCTCTGGTGTTGCTGTCGCTGCTAACCTGGTGCCTATTG
CTCTTGGAACCGAGACCGATGGCTCTGTCATCAACCCTGCTCAGCGCAACTCTATTGTTGGCATCAAGCCCACCG
TCGGTCTGACCTCGCGTGCTGGTGTCATCCCGGAATCGACCCACCAGGACACCGTCGGCACCTTCGGCAAGACCG
TCCGTGATGCTGTTTACGCCCTCGATGCCATCTACGGCATTGACCCCCGCGACAACTACACCTCCGCTCAGGAGG
GTCTCACCCCCGTCGGTGGATACACCCAGTTCCTGAGCAACCAGACCGCTCTTAAGGGCGCCGTCTTCGGTATTC
CCTGGAAGTCCTTCTGGGCCCTCGGCGACGCCGACCAAATCGCCCAGCTCCTTGATCTGGTCAAGCTGATCGAGT
CCGCTGGCGCCACCGTCATCAACGGCACCGAGCTGCCCCACTATAAGGAGATTGTCTCGCCCGACGGCTGGAACT
GGGACTATGGCACCACCCGCGGCTACTCCAACGAGTCCTCTTACTCCTACATCAAGGTTGACTTCTACAACAACC
TGCGTGACTACCTGTCCGAGGTCGAGAACACTAACGTCCGCTCTGTCGAGGACCTCGTCCAGTACAACATCGATA
ACTACGGCTCCGAGGGTGGTCTGCCCGGTATCCACCCTGCCTTCGGCTCTGGCCAGGACGGTCTCATCGCTTCCC
TTGAGAGCAAGGGCATTATGAACGAGACATACTTCCAGGCTTTGGAGTTCTGCCGGCGCACTACCCGTGAGGAGG
GTATCGATGCTGCTTTGAAGCACGGCAACCGTACTCTCGACGGTCTCCTTGTGCCTCCCGATGTCGCCCAGAGCG
TTGAGATTGCCGCCCAGGCTGGATACCCCGTTATTACTGTTCCTGGTGGCGTCAGCGATGTCTCGGGCATGCCCT
TTGGCCTTGCTATCATGAACACTGCTTTCTCCGAGGCCACCTTGATCAAGTACGCCAGTGCTATCGAGGATCTGA
AGAAGAACCACGGCGCCAAGTACGACCGTGCACTGCCTGAGTGGCGCGGCTACCTGCAGCGCCCTCTCCCCGTCG
CTTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail