Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g3613.t1
Gene name
Locationscaffold_03:2103123..2104887
Strand-
Gene length (bp)1764
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07731 Cu-oxidase_2 Multicopper oxidase 4.8E-40 411 531
PF07732 Cu-oxidase_3 Multicopper oxidase 3.1E-38 69 184
PF00394 Cu-oxidase Multicopper oxidase 1.1E-31 194 332

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0005507 copper ion binding Yes
GO:0005488 binding No
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g3613.t1
MKIWTTLLILAGVASATSIHHDKHTRLKRDACSGNTASDRQTWCDYDVSTNYYDVVPTTGVTREYYFNIEDVTVA
PDGYSRAAMAVNGTIPGPTIIADWGDDVIVHVTNSLTSKNGSSIHFHGIRQNYTNQNDGVVSITQCPTAPGQTTT
YKWKATQYGTSWYHSHIGLQAYEGVFGGIVINGPATENYDVDKGVLFLNDWSHQTVDQLWYSAEANGPPTLDNGL
INGTNVYGDDDSTTQTGHRFNTSFTAGTSYRFRLVNAAVDTHFKFSIDNHTLTVMAMDLVPIEPFTTTILNIGMG
QRYDIVVSADQSTGSDSFWMRAIPQAACSDNDSADNIKGIVYYGSTISTPTTTEYTYTDSCDDMDISDLVPYLAQ
SASEPYYNSSEPVTLGTNSDSYFRWQLNGTAMQVYWDNPTLLQVWNNDTTFTEESGVIVLPTADKWSYVVIETTL
AVPHPIHLHGHDFFVIAQGTGTYSSSDDTSLTNPPRRDVAMLPASGYLAIAFKTDNPGAWLMHCHIGWHTSEGFA
IQFLERYDEARALIDYDTLNSTCEAWDAYVTESSVEEEDDGI*
Coding >Pro_DTO070G2_2|g3613.t1
ATGAAGATTTGGACCACTCTTTTGATCCTGGCCGGAGTAGCCTCCGCAACCTCGATCCATCACGACAAACATACA
AGGCTAAAGCGGGATGCTTGCTCTGGAAATACCGCCAGTGACAGACAGACCTGGTGCGACTACGACGTGAGCACC
AACTACTACGATGTCGTCCCCACCACCGGCGTGACCAGAGAGTATTACTTCAACATCGAAGATGTCACAGTTGCT
CCCGATGGCTACTCTCGTGCAGCAATGGCAGTCAACGGGACAATTCCAGGCCCTACCATCATAGCTGACTGGGGC
GATGATGTTATCGTTCATGTCACCAACAGTCTGACCTCAAAGAATGGATCTAGCATCCATTTCCACGGCATCCGC
CAGAACTATACCAACCAGAACGACGGTGTTGTATCCATTACTCAATGCCCTACTGCTCCGGGACAGACAACAACC
TACAAGTGGAAAGCTACACAATATGGCACATCATGGTACCATTCTCACATTGGGTTGCAAGCCTACGAAGGTGTT
TTCGGTGGAATTGTGATCAACGGTCCTGCCACTGAGAACTATGATGTGGACAAAGGAGTTTTGTTCCTCAATGAT
TGGAGTCACCAGACTGTTGATCAACTCTGGTACTCTGCCGAGGCCAATGGCCCGCCTACATTAGACAATGGTCTC
ATCAACGGTACCAATGTGTATGGAGATGACGATTCAACGACCCAGACAGGCCATCGCTTCAACACATCATTCACT
GCAGGCACTTCTTATCGCTTCCGTCTTGTGAACGCTGCGGTAGATACCCACTTCAAGTTCTCAATTGACAACCAT
ACTCTGACGGTGATGGCTATGGACTTGGTACCTATCGAGCCATTCACCACAACTATCTTGAACATCGGCATGGGT
CAGCGGTACGATATTGTGGTCAGCGCAGACCAATCCACCGGAAGTGACAGTTTCTGGATGCGCGCAATTCCCCAA
GCCGCCTGCTCCGACAATGACAGCGCAGACAATATCAAAGGCATCGTTTATTATGGCAGCACAATATCCACTCCC
ACCACCACCGAATACACGTACACCGACAGTTGCGACGACATGGACATCTCTGATCTCGTCCCGTATCTGGCCCAG
AGCGCATCGGAACCATACTACAACTCCAGCGAACCAGTCACACTAGGCACAAACTCCGATAGCTACTTCCGCTGG
CAGCTGAACGGGACAGCAATGCAAGTATACTGGGATAACCCGACACTCCTGCAAGTCTGGAATAACGACACGACA
TTCACCGAGGAGAGCGGCGTAATTGTGCTCCCGACCGCAGACAAGTGGTCCTATGTTGTCATCGAAACTACCCTG
GCTGTCCCGCATCCTATCCACTTGCACGGCCACGACTTCTTTGTCATCGCGCAGGGAACGGGCACGTACAGCTCC
TCCGATGACACGAGCTTGACGAACCCGCCCCGCCGGGATGTGGCCATGCTCCCGGCCTCTGGGTACCTTGCCATT
GCGTTCAAGACTGACAATCCCGGAGCTTGGCTGATGCATTGCCATATTGGATGGCATACTTCGGAGGGCTTTGCT
ATTCAGTTCTTGGAGAGGTATGATGAGGCGCGGGCCCTGATTGATTATGATACTTTGAATTCTACTTGTGAGGCG
TGGGATGCATATGTCACAGAGAGTTCGGTCGAGGAGGAGGATGATGGCATATAG
Transcript >Pro_DTO070G2_2|g3613.t1
ATGAAGATTTGGACCACTCTTTTGATCCTGGCCGGAGTAGCCTCCGCAACCTCGATCCATCACGACAAACATACA
AGGCTAAAGCGGGATGCTTGCTCTGGAAATACCGCCAGTGACAGACAGACCTGGTGCGACTACGACGTGAGCACC
AACTACTACGATGTCGTCCCCACCACCGGCGTGACCAGAGAGTATTACTTCAACATCGAAGATGTCACAGTTGCT
CCCGATGGCTACTCTCGTGCAGCAATGGCAGTCAACGGGACAATTCCAGGCCCTACCATCATAGCTGACTGGGGC
GATGATGTTATCGTTCATGTCACCAACAGTCTGACCTCAAAGAATGGATCTAGCATCCATTTCCACGGCATCCGC
CAGAACTATACCAACCAGAACGACGGTGTTGTATCCATTACTCAATGCCCTACTGCTCCGGGACAGACAACAACC
TACAAGTGGAAAGCTACACAATATGGCACATCATGGTACCATTCTCACATTGGGTTGCAAGCCTACGAAGGTGTT
TTCGGTGGAATTGTGATCAACGGTCCTGCCACTGAGAACTATGATGTGGACAAAGGAGTTTTGTTCCTCAATGAT
TGGAGTCACCAGACTGTTGATCAACTCTGGTACTCTGCCGAGGCCAATGGCCCGCCTACATTAGACAATGGTCTC
ATCAACGGTACCAATGTGTATGGAGATGACGATTCAACGACCCAGACAGGCCATCGCTTCAACACATCATTCACT
GCAGGCACTTCTTATCGCTTCCGTCTTGTGAACGCTGCGGTAGATACCCACTTCAAGTTCTCAATTGACAACCAT
ACTCTGACGGTGATGGCTATGGACTTGGTACCTATCGAGCCATTCACCACAACTATCTTGAACATCGGCATGGGT
CAGCGGTACGATATTGTGGTCAGCGCAGACCAATCCACCGGAAGTGACAGTTTCTGGATGCGCGCAATTCCCCAA
GCCGCCTGCTCCGACAATGACAGCGCAGACAATATCAAAGGCATCGTTTATTATGGCAGCACAATATCCACTCCC
ACCACCACCGAATACACGTACACCGACAGTTGCGACGACATGGACATCTCTGATCTCGTCCCGTATCTGGCCCAG
AGCGCATCGGAACCATACTACAACTCCAGCGAACCAGTCACACTAGGCACAAACTCCGATAGCTACTTCCGCTGG
CAGCTGAACGGGACAGCAATGCAAGTATACTGGGATAACCCGACACTCCTGCAAGTCTGGAATAACGACACGACA
TTCACCGAGGAGAGCGGCGTAATTGTGCTCCCGACCGCAGACAAGTGGTCCTATGTTGTCATCGAAACTACCCTG
GCTGTCCCGCATCCTATCCACTTGCACGGCCACGACTTCTTTGTCATCGCGCAGGGAACGGGCACGTACAGCTCC
TCCGATGACACGAGCTTGACGAACCCGCCCCGCCGGGATGTGGCCATGCTCCCGGCCTCTGGGTACCTTGCCATT
GCGTTCAAGACTGACAATCCCGGAGCTTGGCTGATGCATTGCCATATTGGATGGCATACTTCGGAGGGCTTTGCT
ATTCAGTTCTTGGAGAGGTATGATGAGGCGCGGGCCCTGATTGATTATGATACTTTGAATTCTACTTGTGAGGCG
TGGGATGCATATGTCACAGAGAGTTCGGTCGAGGAGGAGGATGATGGCATATAG
Gene >Pro_DTO070G2_2|g3613.t1
ATGAAGATTTGGACCACTCTTTTGATCCTGGCCGGAGTAGCCTCCGCAACCTCGATCCATCACGACAAACATACA
AGGCTAAAGCGGGATGCTTGCTCTGGAAATACCGCCAGTGACAGACAGACCTGGTGCGACTACGACGTGAGCACC
AACTACTACGATGTCGTCCCCACCACCGGCGTGACCAGAGAGTATTACTTCAACATCGAAGATGTCACAGTTGCT
CCCGATGGCTACTCTCGTGCAGCAATGGCAGTCAACGGGACAATTCCAGGCCCTACCATCATAGCTGACTGGGGC
GATGATGTTATCGTTCATGTCACCAACAGTCTGACCTCAAAGAATGGATCTAGCATCCATTTCCACGGCATCCGC
CAGAACTATACCAACCAGAACGACGGTGTTGTATCCATTACTCAATGCCCTACTGCTCCGGGACAGACAACAACC
TACAAGTGGAAAGCTACACAATATGGCACATCATGGTACCATTCTCACATTGGGTTGCAAGCCTACGAAGGTGTT
TTCGGTGGAATTGTGATCAACGGTCCTGCCACTGAGAACTATGATGTGGACAAAGGAGTTTTGTTCCTCAATGAT
TGGAGTCACCAGACTGTTGATCAACTCTGGTACTCTGCCGAGGCCAATGGCCCGCCTACATTAGACAATGGTCTC
ATCAACGGTACCAATGTGTATGGAGATGACGATTCAACGACCCAGACAGGCCATCGCTTCAACACATCATTCACT
GCAGGCACTTCTTATCGCTTCCGTCTTGTGAACGCTGCGGTAGATACCCACTTCAAGTTCTCAATTGACAACCAT
ACTCTGACGGTGATGGCTATGGACTTGGTACCTATCGAGCCATTCACCACAACTATCTTGAACATCGGCATGGGT
AAGAGACCATTTCCCTACCAACCTACATATGACCTTACTAACCCTTATTCCTATCTAGGTCAGCGGTACGATATT
GTGGTCAGCGCAGACCAATCCACCGGAAGTGACAGTTTCTGGATGCGCGCAATTCCCCAAGCCGCCTGCTCCGAC
AATGACAGCGCAGACAATATCAAAGGCATCGTTTATTATGGCAGCACAATATCCACTCCCACCACCACCGAATAC
ACGTACACCGACAGTTGCGACGACATGGACATCTCTGATCTCGTCCCGTATCTGGCCCAGAGCGCATCGGAACCA
TACTACAACTCCAGCGAACCAGTCACACTAGGCACAAACTCCGATAGCTACTTCCGCTGGCAGCTGAACGGGACA
GCAATGCAAGTATACTGGGATAACCCGACACTCCTGCAAGTCTGGAATAACGACACGACATTCACCGAGGAGAGC
GGCGTAATTGTGCTCCCGACCGCAGACAAGTGGTCCTATGTTGTCATCGAAACTACCCTGGCTGTCCCGCATCCT
ATCCACTTGCACGGCCACGACTTCTTTGTCATCGCGCAGGGAACGGGCACGTACAGCTCCTCCGATGACACGAGC
TTGACGAACCCGCCCCGCCGGGATGTGGCCATGCTCCCGGCCTCTGGGTACCTTGCCATTGCGTTCAAGACTGAC
AATCCCGGAGCTTGGCTGATGCATTGCCATATTGGATGGCATACTTCGGAGGGCTTTGCTATTCAGTTCTTGGAG
AGGTATGATGAGGCGCGGGCCCTGATTGATTATGATACTTTGAATTCTACTTGTGAGGCGTGGGATGCATATGTC
ACAGAGAGTTCGGTCGAGGAGGAGGATGATGGCATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail