Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g3534.t1
Gene name
Locationscaffold_03:1890635..1894513
Strand-
Gene length (bp)3878
Transcript length (bp)3324
Coding sequence length (bp)3324
Protein length (aa) 1108

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06775 Seipin Putative adipose-regulatory protein (Seipin) 3.8E-62 53 254
PF03133 TTL Tubulin-tyrosine ligase family 8.0E-55 794 1082
PF01975 SurE Survival protein SurE 1.7E-49 363 580

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0036211 protein modification process Yes
GO:0019915 lipid storage Yes
GO:0043412 macromolecule modification No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0051179 localization No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0051235 maintenance of location No
GO:0019538 protein metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 245 267 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup1093
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g1540.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g1324.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g3486.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g2937.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g2972.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g227.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g1543.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g2119.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g9615.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g476.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g1556.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g1007.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g4180.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g6175.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g1218.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g1852.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g4555.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g7057.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g3534.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g2261.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g3575.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g283.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g1759.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g2139.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g326.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g122.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g1742.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g4657.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g1999.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g4005.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g2852.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g157.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g3415.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g2186.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g3534.t1
MADSEFGDESEYGPSSVREIIMEAILAPFRALVSKSALRLYLNTLLFMGAASFLIGISAIAYGVFYFKFIPTVGL
QREVHLQFGDGNPWGTATFDSEFVALQPYDVSVTLELPRTPSNLDTGNFMLDLTLFSSRPASSLLLGPNSAPISQ
ARRPAIMTYASPLVDVARRVARMPLYVVGWRRESETLEVPMMEQLEFAKGAQNLPQSLRLEIQSYSDMQIYTARV
EFRARLTGLRWIMYYWKITSFVVFSSLFWSVSIVSAGLTWLAMTWIWGTMPKNEIKEEPQDSIKEESEDGNTSDE
SSDVKKEEPEQERRLLSSYPAEVDEAVGMTLWIIWADCDNAKRGGTFFPSILHISTTSPQMHILVTNDDGPPSNQ
SSPYVHSLVRSLQSAGHTVSVILPHQQRSWIGKAHMVGASVKPTYFRPGTLHQEDGTTHNLPRGSDGEHDEGEEW
ILIDSTPASCVQIGLYHYFKERGPVDVIVSGPNYGRNTTALFALSSGTIGAALEGACCGKRSIALSYAFSSRNHD
PVIIAEAAGHSVKLIEHLCANWADGVHLYSVNVPLEPGVSKNKVLYTDMLQNTWTSGSCFQAVDPTPADDPDLQE
EQLRNEGEMAGKQPDQIVGNSQKPSGIQHKHFKWAPSFQDVYRSVEESEPGNDGWTVKEQMTSVTPLRANFMPAP
GISGEIKLSANPPSLYSLVDCDNSYVQEMVERALTCRLGSAFKRVSSVSELPDSSAPFFQYREYERLDFEHIMSR
PSTSLSSAYIIRKALIRKHYLSNTVANWISKHPESALRHHFKPAFDFELDYAEFLDDALLEAFELNDSLAKNEDR
PDSEKEWWILKPGMSDRGQGIRIFNSEDQLREIFEEWEEDSDDESGSERNGDDANDGSAALDTGIVTSQLRHFLV
QPYIDPPLLLPSSSNRKFHIRTYVLASGSLKVYVFKEMLALFAAKGYCAPHEEYDVADLARHLTNTCFQEGGSSN
KDSVRRFWDLDHHVPGFSADWKEKIFDQICSVTGEVFEAAARGMMVHFQTLPNAFELFGVDFLVDALGNVWLLEL
NAYPDFAQTGEDLKEAVIGRLFEEVVDVAVKPFFGLGDGAGTDDMKLVADIDLGRHA*
Coding >Pro_DTO070G2_2|g3534.t1
ATGGCGGACTCAGAATTTGGAGACGAGTCCGAATATGGCCCATCTTCTGTCAGGGAAATCATCATGGAGGCGATC
CTCGCGCCGTTCCGCGCGCTGGTATCCAAGTCCGCCTTACGGCTATACCTGAACACGCTGTTGTTCATGGGCGCC
GCATCATTCCTAATAGGCATCTCCGCAATTGCCTACGGGGTTTTTTATTTTAAATTCATTCCCACGGTCGGACTA
CAACGCGAAGTCCATCTACAATTTGGCGATGGCAACCCCTGGGGTACAGCAACCTTTGACTCGGAATTTGTGGCT
CTTCAGCCCTACGACGTATCCGTGACGCTCGAGCTCCCACGCACACCCTCAAACCTCGATACAGGCAACTTCATG
CTCGACCTCACCCTCTTCTCATCCCGCCCCGCCTCATCCCTCTTACTCGGCCCGAATAGCGCCCCGATCTCGCAG
GCCCGCCGCCCTGCTATCATGACTTATGCTTCGCCGCTGGTAGATGTTGCCCGGAGAGTGGCGCGTATGCCGCTC
TATGTTGTTGGCTGGCGCCGGGAGTCGGAGACACTGGAGGTGCCGATGATGGAGCAGCTTGAGTTTGCGAAGGGG
GCGCAGAACTTGCCGCAGAGTCTGAGGCTGGAGATCCAAAGTTACTCGGACATGCAGATTTACACTGCCCGGGTG
GAGTTCCGTGCTAGGCTTACAGGGCTTAGATGGATTATGTATTATTGGAAGATTACGTCTTTTGTTGTTTTCAGC
TCTTTGTTCTGGTCGGTCTCTATTGTCTCTGCTGGCTTGACGTGGCTGGCCATGACTTGGATTTGGGGGACTATG
CCTAAGAATGAGATCAAGGAGGAGCCGCAGGACTCTATCAAAGAAGAGTCCGAGGACGGGAATACTTCTGATGAA
TCTTCCGATGTCAAAAAGGAAGAGCCCGAGCAGGAGAGGAGGTTGCTCTCAAGCTATCCGGCTGAGGTTGATGAA
GCTGTGGGAATGACATTGTGGATCATCTGGGCCGATTGCGACAACGCAAAGCGGGGGGGAACTTTCTTCCCTTCC
ATCCTTCACATCTCAACCACTTCACCCCAAATGCATATCCTGGTCACCAACGACGACGGTCCTCCGTCAAACCAG
TCATCGCCGTACGTGCATTCGCTTGTCCGCTCGCTCCAGTCCGCAGGTCATACGGTCTCGGTCATTCTACCACAC
CAGCAACGATCATGGATAGGTAAAGCGCACATGGTAGGCGCCTCTGTCAAACCTACCTACTTCCGGCCCGGCACG
CTCCATCAAGAAGACGGGACAACACACAACCTGCCCCGTGGCAGTGATGGTGAACACGACGAAGGCGAAGAGTGG
ATTTTGATCGACTCAACTCCCGCGAGCTGTGTCCAGATCGGCCTATACCACTACTTCAAAGAACGTGGCCCTGTC
GATGTGATTGTCTCCGGTCCGAACTATGGTCGCAACACAACGGCATTATTCGCATTGTCGAGCGGAACCATTGGC
GCAGCGTTGGAAGGTGCCTGCTGTGGCAAGCGCTCAATTGCTCTGTCGTATGCTTTCAGCTCTCGAAACCATGAC
CCTGTTATCATCGCAGAGGCCGCGGGCCATTCAGTCAAGTTGATTGAGCATCTTTGCGCGAACTGGGCAGATGGG
GTGCACCTCTATAGCGTCAATGTTCCCCTCGAACCCGGCGTTAGTAAGAACAAGGTCTTATATACCGACATGCTG
CAGAACACGTGGACATCCGGGAGTTGCTTCCAGGCTGTCGACCCCACACCCGCAGACGACCCTGATTTGCAAGAA
GAGCAACTACGCAACGAAGGCGAAATGGCAGGAAAGCAACCAGATCAGATTGTCGGTAACAGCCAGAAGCCATCC
GGAATTCAGCACAAGCATTTCAAGTGGGCACCGAGTTTCCAGGATGTTTACCGAAGTGTGGAGGAAAGTGAGCCT
GGCAATGATGGCTGGACTGTTAAGGAGCAAATGACTAGCGTCACGCCCCTCAGGGCCAATTTCATGCCCGCGCCC
GGTATTTCGGGGGAGATTAAGCTATCGGCTAATCCGCCCTCGTTGTACTCCCTCGTCGACTGCGATAACTCCTAC
GTGCAAGAAATGGTTGAACGGGCATTAACATGTCGCCTGGGAAGTGCCTTCAAGCGTGTGTCTTCTGTGTCCGAG
CTGCCGGACTCATCTGCGCCATTTTTCCAGTACCGGGAATATGAGCGCCTCGATTTCGAGCATATCATGTCCAGG
CCCTCGACGTCTCTTTCAAGCGCGTACATCATCCGGAAAGCTTTAATTCGCAAGCACTATCTCTCAAACACAGTG
GCCAATTGGATCTCGAAACACCCAGAGAGCGCTCTTCGACACCACTTCAAGCCCGCCTTCGACTTCGAACTCGAT
TATGCCGAATTCCTCGACGACGCCCTGCTAGAAGCATTCGAGTTGAACGACAGCTTAGCTAAGAACGAAGATCGA
CCTGACTCCGAAAAGGAATGGTGGATCCTCAAGCCCGGCATGAGCGATCGAGGCCAGGGAATCCGCATCTTCAAC
AGCGAAGACCAGCTACGCGAGATCTTCGAGGAGTGGGAAGAAGACTCAGACGACGAGAGCGGATCCGAGAGAAAT
GGCGACGACGCGAATGACGGCAGCGCCGCCCTAGACACAGGGATCGTCACTTCGCAGCTCCGCCACTTCCTCGTA
CAGCCCTATATTGACCCACCTCTCCTCCTCCCGTCATCCTCAAACCGTAAATTCCACATCCGCACCTATGTCCTC
GCCTCGGGATCACTCAAAGTCTACGTCTTCAAGGAGATGCTCGCGCTCTTCGCTGCGAAGGGCTACTGCGCTCCG
CATGAAGAGTACGACGTCGCCGACCTCGCGCGCCATCTGACCAACACCTGTTTCCAGGAAGGCGGCAGCTCGAAC
AAGGATAGTGTGCGCCGCTTCTGGGATCTCGACCACCACGTCCCCGGTTTCAGTGCAGACTGGAAGGAGAAGATC
TTTGATCAGATCTGCTCGGTGACCGGTGAGGTGTTTGAGGCTGCGGCCCGCGGTATGATGGTTCATTTCCAGACT
CTGCCCAATGCGTTTGAGCTGTTTGGTGTTGATTTCCTCGTTGACGCTCTTGGGAATGTGTGGCTGCTGGAGCTC
AACGCGTACCCGGATTTCGCGCAGACTGGTGAGGATCTGAAGGAGGCTGTTATTGGGCGTTTGTTTGAGGAGGTG
GTTGATGTTGCTGTCAAGCCGTTCTTTGGGCTGGGTGACGGGGCTGGTACTGATGATATGAAGCTGGTTGCTGAT
ATTGATCTCGGCAGACATGCTTAA
Transcript >Pro_DTO070G2_2|g3534.t1
ATGGCGGACTCAGAATTTGGAGACGAGTCCGAATATGGCCCATCTTCTGTCAGGGAAATCATCATGGAGGCGATC
CTCGCGCCGTTCCGCGCGCTGGTATCCAAGTCCGCCTTACGGCTATACCTGAACACGCTGTTGTTCATGGGCGCC
GCATCATTCCTAATAGGCATCTCCGCAATTGCCTACGGGGTTTTTTATTTTAAATTCATTCCCACGGTCGGACTA
CAACGCGAAGTCCATCTACAATTTGGCGATGGCAACCCCTGGGGTACAGCAACCTTTGACTCGGAATTTGTGGCT
CTTCAGCCCTACGACGTATCCGTGACGCTCGAGCTCCCACGCACACCCTCAAACCTCGATACAGGCAACTTCATG
CTCGACCTCACCCTCTTCTCATCCCGCCCCGCCTCATCCCTCTTACTCGGCCCGAATAGCGCCCCGATCTCGCAG
GCCCGCCGCCCTGCTATCATGACTTATGCTTCGCCGCTGGTAGATGTTGCCCGGAGAGTGGCGCGTATGCCGCTC
TATGTTGTTGGCTGGCGCCGGGAGTCGGAGACACTGGAGGTGCCGATGATGGAGCAGCTTGAGTTTGCGAAGGGG
GCGCAGAACTTGCCGCAGAGTCTGAGGCTGGAGATCCAAAGTTACTCGGACATGCAGATTTACACTGCCCGGGTG
GAGTTCCGTGCTAGGCTTACAGGGCTTAGATGGATTATGTATTATTGGAAGATTACGTCTTTTGTTGTTTTCAGC
TCTTTGTTCTGGTCGGTCTCTATTGTCTCTGCTGGCTTGACGTGGCTGGCCATGACTTGGATTTGGGGGACTATG
CCTAAGAATGAGATCAAGGAGGAGCCGCAGGACTCTATCAAAGAAGAGTCCGAGGACGGGAATACTTCTGATGAA
TCTTCCGATGTCAAAAAGGAAGAGCCCGAGCAGGAGAGGAGGTTGCTCTCAAGCTATCCGGCTGAGGTTGATGAA
GCTGTGGGAATGACATTGTGGATCATCTGGGCCGATTGCGACAACGCAAAGCGGGGGGGAACTTTCTTCCCTTCC
ATCCTTCACATCTCAACCACTTCACCCCAAATGCATATCCTGGTCACCAACGACGACGGTCCTCCGTCAAACCAG
TCATCGCCGTACGTGCATTCGCTTGTCCGCTCGCTCCAGTCCGCAGGTCATACGGTCTCGGTCATTCTACCACAC
CAGCAACGATCATGGATAGGTAAAGCGCACATGGTAGGCGCCTCTGTCAAACCTACCTACTTCCGGCCCGGCACG
CTCCATCAAGAAGACGGGACAACACACAACCTGCCCCGTGGCAGTGATGGTGAACACGACGAAGGCGAAGAGTGG
ATTTTGATCGACTCAACTCCCGCGAGCTGTGTCCAGATCGGCCTATACCACTACTTCAAAGAACGTGGCCCTGTC
GATGTGATTGTCTCCGGTCCGAACTATGGTCGCAACACAACGGCATTATTCGCATTGTCGAGCGGAACCATTGGC
GCAGCGTTGGAAGGTGCCTGCTGTGGCAAGCGCTCAATTGCTCTGTCGTATGCTTTCAGCTCTCGAAACCATGAC
CCTGTTATCATCGCAGAGGCCGCGGGCCATTCAGTCAAGTTGATTGAGCATCTTTGCGCGAACTGGGCAGATGGG
GTGCACCTCTATAGCGTCAATGTTCCCCTCGAACCCGGCGTTAGTAAGAACAAGGTCTTATATACCGACATGCTG
CAGAACACGTGGACATCCGGGAGTTGCTTCCAGGCTGTCGACCCCACACCCGCAGACGACCCTGATTTGCAAGAA
GAGCAACTACGCAACGAAGGCGAAATGGCAGGAAAGCAACCAGATCAGATTGTCGGTAACAGCCAGAAGCCATCC
GGAATTCAGCACAAGCATTTCAAGTGGGCACCGAGTTTCCAGGATGTTTACCGAAGTGTGGAGGAAAGTGAGCCT
GGCAATGATGGCTGGACTGTTAAGGAGCAAATGACTAGCGTCACGCCCCTCAGGGCCAATTTCATGCCCGCGCCC
GGTATTTCGGGGGAGATTAAGCTATCGGCTAATCCGCCCTCGTTGTACTCCCTCGTCGACTGCGATAACTCCTAC
GTGCAAGAAATGGTTGAACGGGCATTAACATGTCGCCTGGGAAGTGCCTTCAAGCGTGTGTCTTCTGTGTCCGAG
CTGCCGGACTCATCTGCGCCATTTTTCCAGTACCGGGAATATGAGCGCCTCGATTTCGAGCATATCATGTCCAGG
CCCTCGACGTCTCTTTCAAGCGCGTACATCATCCGGAAAGCTTTAATTCGCAAGCACTATCTCTCAAACACAGTG
GCCAATTGGATCTCGAAACACCCAGAGAGCGCTCTTCGACACCACTTCAAGCCCGCCTTCGACTTCGAACTCGAT
TATGCCGAATTCCTCGACGACGCCCTGCTAGAAGCATTCGAGTTGAACGACAGCTTAGCTAAGAACGAAGATCGA
CCTGACTCCGAAAAGGAATGGTGGATCCTCAAGCCCGGCATGAGCGATCGAGGCCAGGGAATCCGCATCTTCAAC
AGCGAAGACCAGCTACGCGAGATCTTCGAGGAGTGGGAAGAAGACTCAGACGACGAGAGCGGATCCGAGAGAAAT
GGCGACGACGCGAATGACGGCAGCGCCGCCCTAGACACAGGGATCGTCACTTCGCAGCTCCGCCACTTCCTCGTA
CAGCCCTATATTGACCCACCTCTCCTCCTCCCGTCATCCTCAAACCGTAAATTCCACATCCGCACCTATGTCCTC
GCCTCGGGATCACTCAAAGTCTACGTCTTCAAGGAGATGCTCGCGCTCTTCGCTGCGAAGGGCTACTGCGCTCCG
CATGAAGAGTACGACGTCGCCGACCTCGCGCGCCATCTGACCAACACCTGTTTCCAGGAAGGCGGCAGCTCGAAC
AAGGATAGTGTGCGCCGCTTCTGGGATCTCGACCACCACGTCCCCGGTTTCAGTGCAGACTGGAAGGAGAAGATC
TTTGATCAGATCTGCTCGGTGACCGGTGAGGTGTTTGAGGCTGCGGCCCGCGGTATGATGGTTCATTTCCAGACT
CTGCCCAATGCGTTTGAGCTGTTTGGTGTTGATTTCCTCGTTGACGCTCTTGGGAATGTGTGGCTGCTGGAGCTC
AACGCGTACCCGGATTTCGCGCAGACTGGTGAGGATCTGAAGGAGGCTGTTATTGGGCGTTTGTTTGAGGAGGTG
GTTGATGTTGCTGTCAAGCCGTTCTTTGGGCTGGGTGACGGGGCTGGTACTGATGATATGAAGCTGGTTGCTGAT
ATTGATCTCGGCAGACATGCTTAA
Gene >Pro_DTO070G2_2|g3534.t1
ATGGCGGACTCAGAATTTGGAGACGAGTCCGAATATGGCCCATCTTCTGTCAGGGAAATCATCATGGTGGGTGTA
TTGATGCATATTTCTCAGCTGCAACTGACACAAGACAGGAGGCGATCCTCGCGCCGTTCCGCGCGCTGGTATCCA
AGTCCGCCTTACGGCTATACCTGAACACGCTGTTGTTCATGGGCGCCGCATCATTCCTAATAGGCATCTCCGCAA
TTGCCTACGGGGTTTTTTATTTTAAATTCATTCCCACGGTCGGACTACAACGCGAAGTCCATCTACAATTTGGGT
ATAACAACATTCCCCACAAAGACACCCAGCTCAACTAACTTGTGCAAGCGATGGCAACCCCTGGGGTACAGCAAC
CTTTGACTCGGAATTTGTGGCTCTTCAGCCCTACGACGTATCCGTGACGCTCGAGCTCCCACGCACACCCTCAAA
CCTCGATACAGGCAACTTCATGCTCGACCTCACCCTCTTCTCATCCCGCCCCGCCTCATCCCTCTTACTCGGCCC
GAATAGCGCCCCGATCTCGCAGGCCCGCCGCCCTGCTATCATGACTTATGCTTCGCCGCTGGTAGATGTTGCCCG
GAGAGTGGCGCGTATGCCGCTCTATGTTGTTGGCTGGCGCCGGGAGTCGGAGACACTGGAGGTGCCGATGATGGA
GCAGCTTGAGTTTGCGAAGGGGGCGCAGAACTTGCCGCAGAGTCTGAGGCTGGAGATCCAAAGTTACTCGGACAT
GCAGATTTACACTGCCCGGGTGGAGTTCCGTGCTAGGCTTACAGGGCTTAGGTAGGTCTTCTTGGGGATTAGGTG
GTTTGTGGGATATGGCTAACAGATGATAGATGGATTATGTATTATTGGAAGATTACGTCTTTTGTTGTTTTCAGC
TCTTTGTTCTGGTCGGTCTCTATTGTCTCTGCTGGCTTGACGTGGCTGGCCATGACTTGGATTTGGGGGACTATG
CCTAAGAATGAGATCAAGGAGGAGCCGCAGGACTCTATCAAAGAAGAGTCCGAGGACGGGAATACTTCTGATGAA
TCTTCCGATGTCAAAAAGGAAGAGCCCGAGCAGGAGAGGAGGTTGCTCTCAAGCTATCCGGCTGAGGTTGATGAA
GCTGGTACAGGCTCTGGACTAGAAAGCGCAGAAGCTCGTGGAGTACAGAGACGGCGCAGTCATTTGACACAATCA
CAATGATGTGTTTTCATTGGCCTAGCTGAGCTGAATGGTACTATATGTTGTAATGTCTTATGATAGTGGGAATGA
CATTGTGGATCATCTGGGCCGATTGCGACAACGCAAAGCGGGGGGGAACTTTCTTCCCTTCCATCCTTCACATCT
CAACCACTTCACCCCAAATGCATATCCTGGTAAGCAGATATAGATACTGCAATGTCAGCTTGAAGACTTATCTCT
ATCTAGGTCACCAACGACGACGGTCCTCCGTCAAACCAGTCATCGCCGTACGTGCATTCGCTTGTCCGCTCGCTC
CAGTCCGCAGGTCATACGGTCTCGGTCATTCTACCACACCAGCAACGATCATGGATAGGTAAAGCGCACATGGTA
GGCGCCTCTGTCAAACCTACCTACTTCCGGCCCGGCACGCTCCATCAAGAAGACGGGACAACACACAACCTGCCC
CGTGGCAGTGATGGTGAACACGACGAAGGCGAAGAGTGGATTTTGATCGACTCAACTCCCGCGAGCTGTGTCCAG
ATCGGCCTATACCACTACTTCAAAGAACGTGGCCCTGTCGATGTGATTGTCTCCGGTCCGAACTATGGTCGCAAC
ACAACGGCATTATTCGCATTGTCGAGCGGAACCATTGGCGCAGCGTTGGAAGGTGCCTGCTGTGGCAAGCGCTCA
ATTGCTCTGTCGTATGCTTTCAGCTCTCGAAACCATGACCCTGTTATCATCGCAGAGGCCGCGGGCCATTCAGTC
AAGTTGATTGAGCATCTTTGCGCGAACTGGGCAGATGGGGTGCACCTCTATAGCGTCAATGTTCCCCTCGAACCC
GGCGTTAGTAAGAACAAGGTCTTATATACCGACATGCTGCAGAACACGTGGACATCCGGGAGTTGCTTCCAGGCT
GTCGACCCCACACCCGCAGACGACCCTGATTTGCAAGAAGAGCAACTACGCAACGAAGGCGAAATGGCAGGAAAG
CAACCAGATCAGATTGTCGGTAACAGCCAGAAGCCATCCGGAATTCAGCACAAGCATTTCAAGTGGGCACCGAGT
TTCCAGGATGTTTACCGAAGTGTGGAGGAAAGTGAGCCTGGCAATGATGGCTGGACTGTTAAGGAGCAAATGACT
AGGTTTGTTCAATGCCCTCTTACTTTTGGACATCGACTGACTTTTACAGCGTCACGCCCCTCAGGGCCAATTTCA
TGCCCGCGCCCGGTATTTCGGGGGAGATTAAGCTGTGAGTGACGACTTTGACGCCATGCATGGTATGGAGGGTTC
TATCCGAAATCTATATGTTGCACCCACCTTAGATATCTGGCTTAGCTGTTAGATACTATATCCCCTCCCCTTTGA
TTTGATTTTCTTTAAGTATTGGCACCCTTTCTGATAGACGGAGATCTTGTAGATCGGCTAATCCGCCCTCGTTGT
ACTCCCTCGTCGACTGCGATAACTCCTACGTGCAAGAAATGGTTGAACGGGCATTAACATGTCGCCTGGGAAGTG
CCTTCAAGCGTGTGTCTTCTGTGTCCGAGCTGCCGGACTCATCTGCGCCATTTTTCCAGTACCGGGAATATGAGC
GCCTCGATTTCGAGCATATCATGTCCAGGCCCTCGACGTCTCTTTCAAGCGCGTACATCATCCGGAAAGCTTTAA
TTCGCAAGCACTATCTCTCAAACACAGTGGCCAATTGGATCTCGAAACACCCAGAGAGCGCTCTTCGACACCACT
TCAAGCCCGCCTTCGACTTCGAACTCGATTATGCCGAATTCCTCGACGACGCCCTGCTAGAAGCATTCGAGTTGA
ACGACAGCTTAGCTAAGAACGAAGATCGACCTGACTCCGAAAAGGAATGGTGGATCCTCAAGCCCGGCATGAGCG
ATCGAGGCCAGGGAATCCGCATCTTCAACAGCGAAGACCAGCTACGCGAGATCTTCGAGGAGTGGGAAGAAGACT
CAGACGACGAGAGCGGATCCGAGAGAAATGGCGACGACGCGAATGACGGCAGCGCCGCCCTAGACACAGGGATCG
TCACTTCGCAGCTCCGCCACTTCCTCGTACAGCCCTATATTGACCCACCTCTCCTCCTCCCGTCATCCTCAAACC
GTAAATTCCACATCCGCACCTATGTCCTCGCCTCGGGATCACTCAAAGTCTACGTCTTCAAGGAGATGCTCGCGC
TCTTCGCTGCGAAGGGCTACTGCGCTCCGCATGAAGAGTACGACGTCGCCGACCTCGCGCGCCATCTGACCAACA
CCTGTTTCCAGGAAGGCGGCAGCTCGAACAAGGATAGTGTGCGCCGCTTCTGGGATCTCGACCACCACGTCCCCG
GTTTCAGTGCAGACTGGAAGGAGAAGATCTTTGATCAGATCTGCTCGGTGACCGGTGAGGTGTTTGAGGCTGCGG
CCCGCGGTATGATGGTTCATTTCCAGACTCTGCCCAATGCGTTTGAGCTGTTTGGTGTTGATTTCCTCGTTGACG
CTCTTGGGAATGTGTGGCTGCTGGAGCTCAACGCGTACCCGGATTTCGCGCAGACTGGTGAGGATCTGAAGGAGG
CTGTTATTGGGCGTTTGTTTGAGGAGGTGGTTGATGTTGCTGTCAAGCCGTTCTTTGGGCTGGGTGACGGGGCTG
GTACTGATGATATGAAGCTGGTTGCTGATATTGATCTCGGCAGACATGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail