Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g3377.t1
Gene name
Locationscaffold_03:1490557..1498657
Strand-
Gene length (bp)8100
Transcript length (bp)7662
Coding sequence length (bp)7662
Protein length (aa) 2554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 6.8E-68 41 290
PF08659 KR KR domain 2.9E-61 2184 2361
PF14765 PS-DH Polyketide synthase dehydratase 7.0E-58 966 1280
PF00698 Acyl_transf_1 Acyl transferase domain 2.0E-46 577 878
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 2.1E-40 299 416
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 1.9E-15 2027 2160
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.4E-14 1985 2090
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 8.7E-15 418 515
PF00106 adh_short short chain dehydrogenase 1.1E-12 2187 2361
PF00550 PP-binding Phosphopantetheine attachment site 2.3E-08 2478 2543

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g3377.t1
MNGSVRKAVRPMIIPVSPTPSPSDGDTDHSLAPELDLPVMPIAVIGMACRFPGDATSPEKLWELCANARSAWSPI
PSNRFNQAAWYHPDKEHLGTSYVKGAHFLTQDASQFDASFFNLSSETASAMDPEVRMQLETVYEALENAGIPLEQ
VAGSRTAVFAGTCFRDNHDSLMRDPDTLARFYLTGNGAAMIANRVSHFYDLRGPSLMIDTGCSTTLTLLHLACQS
LRANESNMAIVGGSNVLLNPDMFISGTNLSLLSAEGKCFAFDSRASGYGRGDGVATILIKPLETALRDGDPIRAV
IRNTAANQDGKTATLTSPSQEAQQTLMRECYEVAALNPVDTAYVEAHGTGTQAGDTIEAHALGTVFGNGRPGEHP
LLIGSVKTNIGHTEAASGLAGIIKAVMALEKGKIPPHLNYESPNEKISLETLKLKIPLSLQSWPSHSLRRASINN
FGYGGANAHAILEHPQYLLPLLAPSTELCSPNPKARSRVFVLSAKDQQTTRTMVDQLRQYVSEAGERSESKNDHL
MDQLALTLGQRRSRFAWTVACQADSLAALQSTLDSTQLSPHRSSRAPRLGMIFTGQGAQWHAMGRELLSAYPVFW
QTIGEVDECLRSMGASWSVVEELQRDANESRVNQVSHSLPLSVAVQIALVNLLRSWGIHPTGVTGHSSGEVGAAY
AAGAISLSAAMAIVYSRGDLTSQFQRLLDRAGGMVAVGLGRENAQAVLSRVQSGKAVIACVNSPSSVTISGDMIA
IEEIEAILAQEQVFARRLKVEAAYHSHHMLPIADDYREMLSRFLQPEPGYDGGITYSSPTTGDRMYSGEEIASPE
HWVRNMVQPVEFLDALRNLCVNPAETDGTPAVDLLIEVGPHGALAGPVRQTLQLPELQPAGIAYESCLTRGENAV
QTMHRLVSSLVKQGYPVDLGAVNFPYSHQGIPMLTDLPTYPWNHETSYWTEPRMNRDLRTRTFAPHDLLGVAAAD
STPSTPSWRYVIRPRDVPWVRDHVVQGSIIYPGAGYISMVVEGLRQLGGGEFSLTPSGYQLQDVQIRNPLILDDT
SAAGVEVRTSMRPTADGVLRVQGWYDFQIQSVDTQGKWTIHCEGQCATIAPHNGSGWVGPAFVDSGIDNQAEQGN
WRTIDPADTYKALHAVGVNHGPIFQNLIAAQSMPGHSISTFKVADTADSMPHRHQQPHLIQPTTLDSVFQGVYHN
LPSGGTDQRTALIPTAIKSLYIASSLSAEPGHIFESHSSLIRSGPHGFESSVRLVDATTPGPHREPVLRIEGLFF
RSLGGTATIDEPHDNLCYQAIWKPDVDFVTAADLRPSQASNLGAKQLKFSRLQEMAVVFLSAVLREIKEETVTAD
NQAYWTWMKSVVDEARPTLDLDGMSAEYVLALASDLEEVEEGRLLTRFARALPDILSGQTDARIVAEHCHFELLE
RSSSQPADFCVSVVQDLLGLYSYKSLQSKILEISNGSFQTTRMILDALTAGTDRGFSDYDMATLELQEARATTDE
DALKDYDGRVHFKTYTPSEFPEDQGFSPETYDLIILSSALCITGDVEQILKNVRTLLKPGGKCLIFGHSIQDSAI
QVILRLMPQWKGVTSLESWKGPLERAGLDPCALQVVQGLDAESYRGEVILASILPPEVAKELPSSRQIMLVYSTA
APPESWVQSLRATLHQHGSYSLSVHSLEEAVNVESGVCVFLDDLVSPLLHNLTQDQFNALRHLLGFSQGSLWVSR
GAQAITEEPWGALHQGLLRTLRCENTAKRYVSLDLAPESAAWSAHSADVVARILHVGFYLSPHNKLETEYSVRSN
VVHISRVCENVHETQLVSGLSLRREPELKPFFEIGHPVRLGVTTPGLLSSLEFGHDPLANEPLPDGYVEIEPRAF
GLNFRDVMVALGQLDEIRMGFECSGVIAHVTPQARAAGFREGDYVYAFIIGYFATRVRIPYTSVAPIPVGMDFPT
AASVPLVFITAYHALYDLAHLKPGETVLIHSGTGGVGQAAIMLAQAAGAEIFVTVGSEEKRDFIAEHYGISPSRI
FSSRNDSFVDHIMHATNGKGVDVVLNSLAGPLLRQTWRCIGTFGRFIEIGKKDIEQNSMVEMGPFVRSVLFASLD
LITLGEQRGPEVARIFGEINTLLEAGQIRPVSPITTFSMGEVEKAFRTMQTGKHIGKIILQPRPGDIVKVLPPAP
KPIILSPKASYLVVGGLGGIGKSVAQMLVDRGARHLVLLSRSASTLDHSRKAFVRSLEAHGTTVTLHSCDIADKS
QLMAVFADCARRMLPVKGVIQAAMVLKDCIFEQMKWADYMAALRPKVQGSWNLHELLLDADFFVLLSSISGFGGN
AGQANYAAGGSFQDALARHRAAQGLSAVSIDLGMVSSVGVVAGTQRVADHLTKLGLRAVSEQEVLGLVESAIRDP
RRTSTTCQVVTGIPSTFTRSDSAAFWNHDTRFAGLEQRGDLTGSGEGSAGPDGSGPNIKKQLTASTTLLEAVQTI
THALVGILAGMFSRPVSEIDPNMSLSQFGVDSLVAVELRNWLVATFEAECSLFDVMHSSSVTALATLVAHKSKLV
CVG*
Coding >Pro_DTO070G2_2|g3377.t1
ATGAACGGATCTGTGCGCAAAGCGGTTCGCCCAATGATTATCCCAGTGTCTCCAACTCCTAGTCCCAGCGATGGC
GATACGGATCACTCCCTCGCACCAGAGCTTGACCTGCCCGTCATGCCCATTGCCGTCATTGGCATGGCCTGCCGC
TTTCCTGGGGATGCCACCAGCCCCGAAAAGCTGTGGGAACTTTGTGCCAACGCCCGCAGTGCCTGGTCCCCCATT
CCTTCGAATCGCTTCAACCAGGCGGCCTGGTATCATCCAGACAAGGAGCACCTCGGGACGTCGTACGTGAAAGGA
GCACACTTTCTAACCCAAGATGCCTCCCAATTTGATGCGTCGTTTTTCAACCTCTCTTCCGAAACGGCTAGTGCA
ATGGACCCGGAGGTCAGAATGCAACTGGAAACGGTATACGAGGCGTTGGAGAATGCCGGCATTCCCCTCGAACAG
GTGGCGGGCTCGCGAACGGCCGTGTTTGCAGGGACCTGCTTTCGAGATAATCACGACAGCTTAATGCGAGACCCA
GACACCCTTGCGCGCTTCTATTTGACAGGGAATGGGGCGGCCATGATTGCAAACCGGGTATCCCATTTCTATGAT
CTACGAGGCCCCAGTCTCATGATCGACACCGGCTGCTCCACCACTCTCACCCTACTTCATCTAGCCTGCCAGAGC
CTGCGAGCTAACGAGAGCAACATGGCCATCGTAGGGGGATCGAATGTTCTCCTGAACCCGGATATGTTTATTTCC
GGAACCAACCTCAGTCTTCTCTCCGCGGAAGGAAAGTGCTTTGCTTTTGACTCCCGGGCATCGGGGTATGGTCGC
GGGGACGGCGTGGCCACCATCCTAATTAAGCCCCTGGAGACGGCCCTCCGCGACGGCGATCCCATTCGCGCGGTG
ATCCGCAATACCGCCGCTAACCAGGATGGGAAAACGGCCACCCTGACGTCACCGAGCCAGGAGGCACAGCAGACG
CTCATGCGGGAATGCTATGAAGTGGCGGCTCTAAACCCCGTTGATACGGCCTATGTCGAGGCCCACGGGACCGGG
ACCCAGGCTGGAGACACCATTGAAGCGCATGCACTGGGCACGGTCTTTGGCAATGGCCGACCCGGGGAACACCCG
CTTCTGATCGGATCGGTCAAGACGAACATTGGCCATACGGAAGCGGCAAGTGGTCTTGCAGGTATTATCAAGGCG
GTCATGGCATTAGAGAAGGGGAAAATCCCACCGCATTTGAACTATGAGTCCCCCAACGAGAAGATCTCGCTGGAG
ACTTTGAAACTAAAGATCCCGCTCAGCCTGCAGTCATGGCCCTCACACTCGCTACGTCGAGCGTCGATCAATAAC
TTCGGCTATGGAGGCGCCAATGCACACGCTATCCTCGAACACCCACAATATCTCCTTCCTCTCTTGGCCCCGTCG
ACAGAGCTATGCTCCCCGAATCCCAAGGCCCGGTCTCGAGTGTTCGTGCTCAGCGCCAAAGACCAACAGACGACC
CGGACCATGGTCGACCAACTGCGACAATATGTTTCAGAGGCAGGAGAACGATCCGAGTCGAAAAATGACCATCTC
ATGGATCAACTGGCACTTACACTAGGGCAACGACGGTCCCGGTTTGCATGGACAGTGGCCTGCCAAGCAGACTCG
CTGGCCGCCCTGCAGTCGACGCTTGACTCCACACAGCTGTCTCCCCATCGCAGTTCGCGGGCTCCCCGGCTGGGA
ATGATTTTCACTGGCCAAGGTGCCCAGTGGCACGCCATGGGACGGGAGCTCTTAAGCGCCTATCCTGTCTTTTGG
CAGACTATCGGGGAGGTGGATGAATGCCTCCGCTCTATGGGAGCAAGCTGGTCGGTGGTCGAGGAGTTGCAGCGC
GATGCCAACGAGAGCCGCGTCAATCAAGTCTCCCATAGCCTGCCGCTGTCGGTCGCGGTCCAAATCGCCCTAGTC
AATCTCCTCCGATCCTGGGGCATTCACCCCACCGGAGTCACCGGCCATTCGAGCGGAGAGGTTGGCGCTGCATAT
GCCGCCGGGGCTATCAGCCTGTCGGCCGCCATGGCCATCGTCTACAGCCGGGGCGATCTGACCAGTCAGTTTCAA
AGGCTGCTCGACCGTGCAGGCGGGATGGTGGCCGTCGGTCTGGGTCGCGAGAATGCCCAAGCCGTGCTCTCCCGG
GTTCAATCTGGGAAAGCCGTCATTGCGTGCGTCAACAGCCCATCCAGCGTGACTATCTCGGGCGATATGATCGCT
ATTGAGGAGATAGAGGCAATTCTAGCGCAAGAGCAGGTGTTTGCTCGCCGCCTAAAGGTCGAAGCGGCTTATCAC
TCTCACCATATGCTGCCCATTGCCGACGACTATAGGGAAATGTTGTCCCGGTTCTTGCAGCCAGAACCCGGTTAT
GACGGGGGAATTACCTACTCATCCCCGACGACAGGCGATCGTATGTACTCCGGAGAAGAAATCGCGAGTCCAGAG
CACTGGGTACGAAACATGGTACAGCCTGTGGAGTTTCTCGACGCCCTTCGCAACCTCTGTGTTAATCCGGCGGAG
ACTGATGGCACGCCCGCGGTTGATCTGCTCATCGAAGTCGGGCCGCACGGCGCTCTGGCCGGTCCGGTCCGACAG
ACCCTTCAGCTCCCAGAGCTACAGCCAGCGGGAATCGCTTACGAGTCGTGCTTGACAAGGGGGGAGAATGCCGTG
CAGACCATGCACCGTCTGGTCTCGTCGTTAGTCAAACAAGGCTATCCGGTGGATCTCGGGGCGGTCAATTTCCCT
TACAGCCACCAGGGAATACCGATGCTCACCGATCTGCCGACATATCCATGGAATCACGAGACGTCCTACTGGACT
GAACCACGCATGAACCGTGACCTGCGGACAAGGACTTTCGCACCCCACGATCTATTGGGCGTTGCCGCCGCCGAT
TCCACCCCTTCAACACCCAGCTGGCGCTATGTCATTCGTCCTCGGGACGTTCCCTGGGTGCGAGATCACGTCGTC
CAGGGGTCCATTATTTATCCCGGAGCGGGCTACATCAGTATGGTCGTGGAGGGTCTGCGTCAACTTGGTGGCGGT
GAATTCTCGCTAACTCCATCGGGGTACCAGCTGCAGGATGTTCAGATCCGCAATCCGCTCATCCTCGACGATACA
TCGGCCGCCGGAGTCGAGGTTCGCACATCCATGCGCCCCACGGCCGACGGAGTCCTTCGGGTCCAGGGCTGGTAT
GACTTCCAGATCCAGTCGGTTGATACTCAGGGCAAGTGGACTATTCACTGTGAGGGTCAGTGTGCAACTATCGCA
CCACATAACGGAAGTGGATGGGTTGGCCCGGCTTTCGTCGATTCGGGGATTGATAATCAAGCAGAGCAAGGGAAC
TGGAGAACAATTGATCCGGCGGATACATACAAGGCATTGCACGCCGTAGGCGTGAATCACGGCCCGATATTTCAG
AACTTGATCGCTGCGCAATCGATGCCTGGGCACTCTATCTCAACATTCAAAGTGGCTGATACGGCTGACTCCATG
CCGCACCGCCATCAACAACCCCATCTCATACAACCGACCACCCTGGACTCGGTTTTCCAGGGGGTATACCATAAC
CTACCCTCCGGAGGAACGGACCAACGAACGGCCCTGATTCCGACCGCTATCAAGTCATTGTACATTGCGTCTTCG
TTGAGTGCAGAGCCTGGACACATTTTTGAGTCTCATTCGTCCCTCATCCGGTCCGGTCCTCACGGATTTGAGTCC
TCTGTCCGGCTCGTCGATGCAACCACCCCCGGTCCCCATCGGGAGCCGGTACTGAGGATCGAGGGATTATTCTTT
CGGTCACTGGGCGGGACAGCTACGATTGATGAGCCGCATGACAACCTCTGTTACCAGGCTATCTGGAAACCAGAC
GTGGACTTTGTCACTGCCGCCGATCTGCGTCCCTCCCAAGCTTCTAATCTCGGTGCCAAACAGCTCAAATTCTCG
CGACTCCAGGAGATGGCCGTTGTCTTTCTTTCTGCAGTGCTCCGCGAGATTAAAGAAGAGACTGTCACGGCAGAC
AATCAAGCTTATTGGACTTGGATGAAGAGCGTCGTCGACGAGGCTCGGCCCACACTAGACCTCGATGGCATGAGC
GCGGAATACGTCCTGGCGCTGGCGTCGGACCTGGAAGAGGTCGAGGAAGGAAGGCTTCTCACCCGATTTGCTCGA
GCATTACCTGATATCCTTTCTGGACAAACGGACGCTCGAATCGTGGCTGAGCATTGTCACTTCGAACTTCTGGAA
AGGTCTTCATCTCAGCCAGCTGACTTTTGCGTCTCTGTTGTCCAGGACCTGCTAGGTCTGTACAGCTACAAGTCA
CTCCAGTCCAAGATTCTTGAAATCAGCAATGGCAGTTTCCAGACGACCCGTATGATACTAGATGCATTGACAGCA
GGCACGGACCGAGGTTTCAGTGACTACGATATGGCGACTCTGGAGCTGCAAGAGGCACGGGCTACAACAGATGAG
GATGCATTGAAGGATTATGATGGGCGAGTTCACTTCAAGACCTACACCCCTAGCGAGTTTCCAGAGGATCAAGGC
TTTAGTCCTGAGACATACGATTTAATCATTCTATCCTCTGCGCTGTGTATCACTGGGGACGTTGAACAGATTCTC
AAGAATGTTCGAACCTTGCTCAAGCCGGGAGGCAAATGTCTGATATTTGGACACAGCATTCAGGATTCTGCAATC
CAGGTTATCCTGAGGCTGATGCCGCAATGGAAGGGAGTCACCTCCCTCGAATCGTGGAAGGGCCCACTCGAGCGA
GCTGGATTGGACCCCTGCGCCCTTCAGGTTGTACAGGGCCTCGATGCCGAATCATATCGAGGTGAAGTAATTTTG
GCTTCAATTCTTCCACCGGAGGTGGCGAAGGAACTGCCATCATCACGCCAGATCATGTTGGTGTACTCCACAGCT
GCACCGCCGGAGAGCTGGGTACAGTCCCTCAGGGCCACCCTTCATCAACACGGTTCCTACAGTTTGTCGGTTCAC
TCCTTGGAAGAGGCGGTCAACGTTGAGAGTGGTGTTTGTGTCTTCCTCGATGATCTGGTTAGCCCTCTTCTCCAT
AATCTCACTCAGGATCAGTTCAACGCCCTGCGCCATTTGTTGGGCTTCTCCCAGGGCTCCTTATGGGTATCTCGG
GGGGCCCAAGCGATTACGGAGGAGCCGTGGGGTGCTCTCCATCAGGGTTTGTTACGGACCCTCCGATGTGAGAAC
ACTGCCAAGCGCTATGTCTCCTTGGACCTGGCTCCGGAATCTGCGGCATGGAGTGCACACTCGGCCGATGTGGTC
GCACGTATCCTACACGTCGGCTTTTATCTTTCGCCCCATAACAAACTGGAAACGGAATATTCTGTTCGATCCAAT
GTAGTCCACATTTCACGTGTTTGCGAAAACGTGCACGAAACCCAGCTCGTCTCTGGTCTCTCTCTGCGGAGAGAA
CCGGAGCTCAAGCCCTTCTTTGAGATCGGCCATCCAGTTCGCCTCGGAGTGACCACTCCGGGTCTCCTTAGCAGC
CTGGAATTTGGCCATGATCCTTTGGCGAATGAGCCGCTACCTGACGGTTATGTCGAAATCGAGCCACGAGCCTTT
GGACTCAATTTCCGCGATGTCATGGTTGCCCTGGGTCAGTTGGATGAAATCCGGATGGGATTTGAATGTAGCGGA
GTCATCGCCCATGTCACTCCTCAAGCTCGCGCGGCCGGTTTCAGGGAAGGGGATTATGTATACGCCTTTATCATC
GGGTACTTTGCCACCCGTGTGCGCATCCCATACACCAGCGTTGCGCCTATCCCCGTGGGTATGGATTTCCCCACG
GCTGCTTCAGTTCCGCTTGTATTTATTACCGCTTACCATGCCCTTTACGATTTGGCTCATCTGAAGCCCGGAGAG
ACTGTTCTCATCCATTCGGGAACCGGTGGAGTCGGGCAAGCGGCCATCATGCTGGCCCAGGCAGCTGGCGCAGAG
ATCTTTGTGACCGTTGGGTCGGAGGAGAAGCGAGACTTCATCGCTGAGCACTACGGCATCTCTCCGTCTCGGATA
TTCAGCAGTCGAAACGATTCCTTCGTGGATCATATCATGCACGCCACGAACGGAAAGGGAGTCGATGTGGTGTTG
AACTCCCTCGCCGGCCCTCTTCTCCGCCAGACATGGCGCTGCATTGGCACCTTTGGTCGTTTCATCGAAATTGGA
AAGAAGGACATTGAGCAGAACAGTATGGTCGAGATGGGGCCCTTCGTCCGCAGTGTTCTCTTTGCCTCGCTGGAC
TTGATTACTCTGGGGGAACAGCGTGGACCGGAAGTGGCCCGCATCTTTGGCGAGATCAACACCCTGCTCGAGGCC
GGTCAAATCCGTCCGGTGAGCCCTATTACAACGTTCTCCATGGGCGAGGTGGAGAAAGCCTTCCGCACGATGCAA
ACGGGGAAACATATAGGCAAAATCATTTTACAGCCACGGCCCGGCGATATTGTCAAGGTCCTGCCGCCCGCTCCC
AAACCTATTATTCTCTCCCCTAAGGCGAGCTACTTGGTTGTTGGTGGCCTCGGTGGCATAGGAAAATCGGTGGCC
CAAATGCTAGTTGACAGAGGAGCCCGTCATCTCGTCCTGCTCTCCCGCAGTGCCTCGACGCTCGATCATTCTAGG
AAAGCGTTTGTCCGCTCTCTTGAAGCCCATGGCACGACCGTTACCCTGCACAGCTGCGACATCGCCGATAAGAGT
CAGCTGATGGCTGTTTTTGCAGACTGTGCTCGCCGCATGCTACCGGTGAAGGGGGTCATCCAAGCGGCCATGGTT
CTCAAGGACTGCATCTTTGAACAGATGAAGTGGGCTGATTACATGGCCGCCCTCCGTCCGAAGGTCCAGGGCAGC
TGGAATCTTCATGAACTGTTGCTGGATGCGGATTTCTTCGTCCTTCTCTCCTCGATCAGCGGCTTTGGAGGAAAT
GCGGGACAGGCGAACTACGCTGCCGGGGGGAGCTTTCAAGATGCTCTCGCCCGACATCGCGCGGCACAGGGCCTA
TCTGCTGTGTCAATTGATCTGGGAATGGTCTCGTCTGTAGGTGTGGTCGCAGGGACGCAGCGAGTTGCAGACCAT
CTCACCAAACTGGGGCTGCGAGCTGTGTCTGAACAGGAAGTCCTGGGCCTGGTCGAATCCGCGATCCGGGATCCC
CGTCGAACATCCACAACATGCCAGGTAGTCACAGGCATCCCGTCCACGTTTACCCGGTCTGATTCAGCTGCATTC
TGGAATCATGATACCCGTTTTGCTGGGTTAGAACAGCGCGGTGACCTCACCGGTTCCGGGGAAGGCTCCGCCGGT
CCTGACGGTAGCGGGCCCAACATCAAGAAGCAGCTTACCGCGTCGACGACGTTGCTTGAGGCCGTCCAGACCATC
ACACACGCCCTGGTCGGGATTCTCGCAGGCATGTTTAGCAGGCCGGTGTCGGAAATAGACCCCAACATGTCGCTT
TCGCAGTTTGGTGTGGATTCATTAGTGGCGGTTGAGCTGCGCAATTGGCTGGTGGCCACATTCGAGGCCGAGTGC
TCTCTTTTCGACGTGATGCATAGCTCCTCAGTGACCGCATTGGCGACCCTTGTGGCACACAAAAGTAAACTGGTG
TGTGTCGGCTGA
Transcript >Pro_DTO070G2_2|g3377.t1
ATGAACGGATCTGTGCGCAAAGCGGTTCGCCCAATGATTATCCCAGTGTCTCCAACTCCTAGTCCCAGCGATGGC
GATACGGATCACTCCCTCGCACCAGAGCTTGACCTGCCCGTCATGCCCATTGCCGTCATTGGCATGGCCTGCCGC
TTTCCTGGGGATGCCACCAGCCCCGAAAAGCTGTGGGAACTTTGTGCCAACGCCCGCAGTGCCTGGTCCCCCATT
CCTTCGAATCGCTTCAACCAGGCGGCCTGGTATCATCCAGACAAGGAGCACCTCGGGACGTCGTACGTGAAAGGA
GCACACTTTCTAACCCAAGATGCCTCCCAATTTGATGCGTCGTTTTTCAACCTCTCTTCCGAAACGGCTAGTGCA
ATGGACCCGGAGGTCAGAATGCAACTGGAAACGGTATACGAGGCGTTGGAGAATGCCGGCATTCCCCTCGAACAG
GTGGCGGGCTCGCGAACGGCCGTGTTTGCAGGGACCTGCTTTCGAGATAATCACGACAGCTTAATGCGAGACCCA
GACACCCTTGCGCGCTTCTATTTGACAGGGAATGGGGCGGCCATGATTGCAAACCGGGTATCCCATTTCTATGAT
CTACGAGGCCCCAGTCTCATGATCGACACCGGCTGCTCCACCACTCTCACCCTACTTCATCTAGCCTGCCAGAGC
CTGCGAGCTAACGAGAGCAACATGGCCATCGTAGGGGGATCGAATGTTCTCCTGAACCCGGATATGTTTATTTCC
GGAACCAACCTCAGTCTTCTCTCCGCGGAAGGAAAGTGCTTTGCTTTTGACTCCCGGGCATCGGGGTATGGTCGC
GGGGACGGCGTGGCCACCATCCTAATTAAGCCCCTGGAGACGGCCCTCCGCGACGGCGATCCCATTCGCGCGGTG
ATCCGCAATACCGCCGCTAACCAGGATGGGAAAACGGCCACCCTGACGTCACCGAGCCAGGAGGCACAGCAGACG
CTCATGCGGGAATGCTATGAAGTGGCGGCTCTAAACCCCGTTGATACGGCCTATGTCGAGGCCCACGGGACCGGG
ACCCAGGCTGGAGACACCATTGAAGCGCATGCACTGGGCACGGTCTTTGGCAATGGCCGACCCGGGGAACACCCG
CTTCTGATCGGATCGGTCAAGACGAACATTGGCCATACGGAAGCGGCAAGTGGTCTTGCAGGTATTATCAAGGCG
GTCATGGCATTAGAGAAGGGGAAAATCCCACCGCATTTGAACTATGAGTCCCCCAACGAGAAGATCTCGCTGGAG
ACTTTGAAACTAAAGATCCCGCTCAGCCTGCAGTCATGGCCCTCACACTCGCTACGTCGAGCGTCGATCAATAAC
TTCGGCTATGGAGGCGCCAATGCACACGCTATCCTCGAACACCCACAATATCTCCTTCCTCTCTTGGCCCCGTCG
ACAGAGCTATGCTCCCCGAATCCCAAGGCCCGGTCTCGAGTGTTCGTGCTCAGCGCCAAAGACCAACAGACGACC
CGGACCATGGTCGACCAACTGCGACAATATGTTTCAGAGGCAGGAGAACGATCCGAGTCGAAAAATGACCATCTC
ATGGATCAACTGGCACTTACACTAGGGCAACGACGGTCCCGGTTTGCATGGACAGTGGCCTGCCAAGCAGACTCG
CTGGCCGCCCTGCAGTCGACGCTTGACTCCACACAGCTGTCTCCCCATCGCAGTTCGCGGGCTCCCCGGCTGGGA
ATGATTTTCACTGGCCAAGGTGCCCAGTGGCACGCCATGGGACGGGAGCTCTTAAGCGCCTATCCTGTCTTTTGG
CAGACTATCGGGGAGGTGGATGAATGCCTCCGCTCTATGGGAGCAAGCTGGTCGGTGGTCGAGGAGTTGCAGCGC
GATGCCAACGAGAGCCGCGTCAATCAAGTCTCCCATAGCCTGCCGCTGTCGGTCGCGGTCCAAATCGCCCTAGTC
AATCTCCTCCGATCCTGGGGCATTCACCCCACCGGAGTCACCGGCCATTCGAGCGGAGAGGTTGGCGCTGCATAT
GCCGCCGGGGCTATCAGCCTGTCGGCCGCCATGGCCATCGTCTACAGCCGGGGCGATCTGACCAGTCAGTTTCAA
AGGCTGCTCGACCGTGCAGGCGGGATGGTGGCCGTCGGTCTGGGTCGCGAGAATGCCCAAGCCGTGCTCTCCCGG
GTTCAATCTGGGAAAGCCGTCATTGCGTGCGTCAACAGCCCATCCAGCGTGACTATCTCGGGCGATATGATCGCT
ATTGAGGAGATAGAGGCAATTCTAGCGCAAGAGCAGGTGTTTGCTCGCCGCCTAAAGGTCGAAGCGGCTTATCAC
TCTCACCATATGCTGCCCATTGCCGACGACTATAGGGAAATGTTGTCCCGGTTCTTGCAGCCAGAACCCGGTTAT
GACGGGGGAATTACCTACTCATCCCCGACGACAGGCGATCGTATGTACTCCGGAGAAGAAATCGCGAGTCCAGAG
CACTGGGTACGAAACATGGTACAGCCTGTGGAGTTTCTCGACGCCCTTCGCAACCTCTGTGTTAATCCGGCGGAG
ACTGATGGCACGCCCGCGGTTGATCTGCTCATCGAAGTCGGGCCGCACGGCGCTCTGGCCGGTCCGGTCCGACAG
ACCCTTCAGCTCCCAGAGCTACAGCCAGCGGGAATCGCTTACGAGTCGTGCTTGACAAGGGGGGAGAATGCCGTG
CAGACCATGCACCGTCTGGTCTCGTCGTTAGTCAAACAAGGCTATCCGGTGGATCTCGGGGCGGTCAATTTCCCT
TACAGCCACCAGGGAATACCGATGCTCACCGATCTGCCGACATATCCATGGAATCACGAGACGTCCTACTGGACT
GAACCACGCATGAACCGTGACCTGCGGACAAGGACTTTCGCACCCCACGATCTATTGGGCGTTGCCGCCGCCGAT
TCCACCCCTTCAACACCCAGCTGGCGCTATGTCATTCGTCCTCGGGACGTTCCCTGGGTGCGAGATCACGTCGTC
CAGGGGTCCATTATTTATCCCGGAGCGGGCTACATCAGTATGGTCGTGGAGGGTCTGCGTCAACTTGGTGGCGGT
GAATTCTCGCTAACTCCATCGGGGTACCAGCTGCAGGATGTTCAGATCCGCAATCCGCTCATCCTCGACGATACA
TCGGCCGCCGGAGTCGAGGTTCGCACATCCATGCGCCCCACGGCCGACGGAGTCCTTCGGGTCCAGGGCTGGTAT
GACTTCCAGATCCAGTCGGTTGATACTCAGGGCAAGTGGACTATTCACTGTGAGGGTCAGTGTGCAACTATCGCA
CCACATAACGGAAGTGGATGGGTTGGCCCGGCTTTCGTCGATTCGGGGATTGATAATCAAGCAGAGCAAGGGAAC
TGGAGAACAATTGATCCGGCGGATACATACAAGGCATTGCACGCCGTAGGCGTGAATCACGGCCCGATATTTCAG
AACTTGATCGCTGCGCAATCGATGCCTGGGCACTCTATCTCAACATTCAAAGTGGCTGATACGGCTGACTCCATG
CCGCACCGCCATCAACAACCCCATCTCATACAACCGACCACCCTGGACTCGGTTTTCCAGGGGGTATACCATAAC
CTACCCTCCGGAGGAACGGACCAACGAACGGCCCTGATTCCGACCGCTATCAAGTCATTGTACATTGCGTCTTCG
TTGAGTGCAGAGCCTGGACACATTTTTGAGTCTCATTCGTCCCTCATCCGGTCCGGTCCTCACGGATTTGAGTCC
TCTGTCCGGCTCGTCGATGCAACCACCCCCGGTCCCCATCGGGAGCCGGTACTGAGGATCGAGGGATTATTCTTT
CGGTCACTGGGCGGGACAGCTACGATTGATGAGCCGCATGACAACCTCTGTTACCAGGCTATCTGGAAACCAGAC
GTGGACTTTGTCACTGCCGCCGATCTGCGTCCCTCCCAAGCTTCTAATCTCGGTGCCAAACAGCTCAAATTCTCG
CGACTCCAGGAGATGGCCGTTGTCTTTCTTTCTGCAGTGCTCCGCGAGATTAAAGAAGAGACTGTCACGGCAGAC
AATCAAGCTTATTGGACTTGGATGAAGAGCGTCGTCGACGAGGCTCGGCCCACACTAGACCTCGATGGCATGAGC
GCGGAATACGTCCTGGCGCTGGCGTCGGACCTGGAAGAGGTCGAGGAAGGAAGGCTTCTCACCCGATTTGCTCGA
GCATTACCTGATATCCTTTCTGGACAAACGGACGCTCGAATCGTGGCTGAGCATTGTCACTTCGAACTTCTGGAA
AGGTCTTCATCTCAGCCAGCTGACTTTTGCGTCTCTGTTGTCCAGGACCTGCTAGGTCTGTACAGCTACAAGTCA
CTCCAGTCCAAGATTCTTGAAATCAGCAATGGCAGTTTCCAGACGACCCGTATGATACTAGATGCATTGACAGCA
GGCACGGACCGAGGTTTCAGTGACTACGATATGGCGACTCTGGAGCTGCAAGAGGCACGGGCTACAACAGATGAG
GATGCATTGAAGGATTATGATGGGCGAGTTCACTTCAAGACCTACACCCCTAGCGAGTTTCCAGAGGATCAAGGC
TTTAGTCCTGAGACATACGATTTAATCATTCTATCCTCTGCGCTGTGTATCACTGGGGACGTTGAACAGATTCTC
AAGAATGTTCGAACCTTGCTCAAGCCGGGAGGCAAATGTCTGATATTTGGACACAGCATTCAGGATTCTGCAATC
CAGGTTATCCTGAGGCTGATGCCGCAATGGAAGGGAGTCACCTCCCTCGAATCGTGGAAGGGCCCACTCGAGCGA
GCTGGATTGGACCCCTGCGCCCTTCAGGTTGTACAGGGCCTCGATGCCGAATCATATCGAGGTGAAGTAATTTTG
GCTTCAATTCTTCCACCGGAGGTGGCGAAGGAACTGCCATCATCACGCCAGATCATGTTGGTGTACTCCACAGCT
GCACCGCCGGAGAGCTGGGTACAGTCCCTCAGGGCCACCCTTCATCAACACGGTTCCTACAGTTTGTCGGTTCAC
TCCTTGGAAGAGGCGGTCAACGTTGAGAGTGGTGTTTGTGTCTTCCTCGATGATCTGGTTAGCCCTCTTCTCCAT
AATCTCACTCAGGATCAGTTCAACGCCCTGCGCCATTTGTTGGGCTTCTCCCAGGGCTCCTTATGGGTATCTCGG
GGGGCCCAAGCGATTACGGAGGAGCCGTGGGGTGCTCTCCATCAGGGTTTGTTACGGACCCTCCGATGTGAGAAC
ACTGCCAAGCGCTATGTCTCCTTGGACCTGGCTCCGGAATCTGCGGCATGGAGTGCACACTCGGCCGATGTGGTC
GCACGTATCCTACACGTCGGCTTTTATCTTTCGCCCCATAACAAACTGGAAACGGAATATTCTGTTCGATCCAAT
GTAGTCCACATTTCACGTGTTTGCGAAAACGTGCACGAAACCCAGCTCGTCTCTGGTCTCTCTCTGCGGAGAGAA
CCGGAGCTCAAGCCCTTCTTTGAGATCGGCCATCCAGTTCGCCTCGGAGTGACCACTCCGGGTCTCCTTAGCAGC
CTGGAATTTGGCCATGATCCTTTGGCGAATGAGCCGCTACCTGACGGTTATGTCGAAATCGAGCCACGAGCCTTT
GGACTCAATTTCCGCGATGTCATGGTTGCCCTGGGTCAGTTGGATGAAATCCGGATGGGATTTGAATGTAGCGGA
GTCATCGCCCATGTCACTCCTCAAGCTCGCGCGGCCGGTTTCAGGGAAGGGGATTATGTATACGCCTTTATCATC
GGGTACTTTGCCACCCGTGTGCGCATCCCATACACCAGCGTTGCGCCTATCCCCGTGGGTATGGATTTCCCCACG
GCTGCTTCAGTTCCGCTTGTATTTATTACCGCTTACCATGCCCTTTACGATTTGGCTCATCTGAAGCCCGGAGAG
ACTGTTCTCATCCATTCGGGAACCGGTGGAGTCGGGCAAGCGGCCATCATGCTGGCCCAGGCAGCTGGCGCAGAG
ATCTTTGTGACCGTTGGGTCGGAGGAGAAGCGAGACTTCATCGCTGAGCACTACGGCATCTCTCCGTCTCGGATA
TTCAGCAGTCGAAACGATTCCTTCGTGGATCATATCATGCACGCCACGAACGGAAAGGGAGTCGATGTGGTGTTG
AACTCCCTCGCCGGCCCTCTTCTCCGCCAGACATGGCGCTGCATTGGCACCTTTGGTCGTTTCATCGAAATTGGA
AAGAAGGACATTGAGCAGAACAGTATGGTCGAGATGGGGCCCTTCGTCCGCAGTGTTCTCTTTGCCTCGCTGGAC
TTGATTACTCTGGGGGAACAGCGTGGACCGGAAGTGGCCCGCATCTTTGGCGAGATCAACACCCTGCTCGAGGCC
GGTCAAATCCGTCCGGTGAGCCCTATTACAACGTTCTCCATGGGCGAGGTGGAGAAAGCCTTCCGCACGATGCAA
ACGGGGAAACATATAGGCAAAATCATTTTACAGCCACGGCCCGGCGATATTGTCAAGGTCCTGCCGCCCGCTCCC
AAACCTATTATTCTCTCCCCTAAGGCGAGCTACTTGGTTGTTGGTGGCCTCGGTGGCATAGGAAAATCGGTGGCC
CAAATGCTAGTTGACAGAGGAGCCCGTCATCTCGTCCTGCTCTCCCGCAGTGCCTCGACGCTCGATCATTCTAGG
AAAGCGTTTGTCCGCTCTCTTGAAGCCCATGGCACGACCGTTACCCTGCACAGCTGCGACATCGCCGATAAGAGT
CAGCTGATGGCTGTTTTTGCAGACTGTGCTCGCCGCATGCTACCGGTGAAGGGGGTCATCCAAGCGGCCATGGTT
CTCAAGGACTGCATCTTTGAACAGATGAAGTGGGCTGATTACATGGCCGCCCTCCGTCCGAAGGTCCAGGGCAGC
TGGAATCTTCATGAACTGTTGCTGGATGCGGATTTCTTCGTCCTTCTCTCCTCGATCAGCGGCTTTGGAGGAAAT
GCGGGACAGGCGAACTACGCTGCCGGGGGGAGCTTTCAAGATGCTCTCGCCCGACATCGCGCGGCACAGGGCCTA
TCTGCTGTGTCAATTGATCTGGGAATGGTCTCGTCTGTAGGTGTGGTCGCAGGGACGCAGCGAGTTGCAGACCAT
CTCACCAAACTGGGGCTGCGAGCTGTGTCTGAACAGGAAGTCCTGGGCCTGGTCGAATCCGCGATCCGGGATCCC
CGTCGAACATCCACAACATGCCAGGTAGTCACAGGCATCCCGTCCACGTTTACCCGGTCTGATTCAGCTGCATTC
TGGAATCATGATACCCGTTTTGCTGGGTTAGAACAGCGCGGTGACCTCACCGGTTCCGGGGAAGGCTCCGCCGGT
CCTGACGGTAGCGGGCCCAACATCAAGAAGCAGCTTACCGCGTCGACGACGTTGCTTGAGGCCGTCCAGACCATC
ACACACGCCCTGGTCGGGATTCTCGCAGGCATGTTTAGCAGGCCGGTGTCGGAAATAGACCCCAACATGTCGCTT
TCGCAGTTTGGTGTGGATTCATTAGTGGCGGTTGAGCTGCGCAATTGGCTGGTGGCCACATTCGAGGCCGAGTGC
TCTCTTTTCGACGTGATGCATAGCTCCTCAGTGACCGCATTGGCGACCCTTGTGGCACACAAAAGTAAACTGGTG
TGTGTCGGCTGA
Gene >Pro_DTO070G2_2|g3377.t1
ATGAACGGATCTGTGCGCAAAGGTCAGCGATTTAACCAATATCGCCATTTTGACAGCTCATCGATCCAGCGGTTC
GCCCAATGATTATCCCAGTGTCTCCAACTCCTAGTCCCAGCGATGGCGATACGGATCACTCCCTCGCACCAGAGC
TTGACCTGCCCGTCATGCCCATTGCCGTCATTGGCATGGCCTGCCGCTTTCCTGGGGATGCCACCAGCCCCGAAA
AGCTGTGGGAACTTTGTGCCAACGCCCGCAGTGCCTGGTCCCCCATTCCTTCGAATCGCTTCAACCAGGCGGCCT
GGTATCATCCAGACAAGGAGCACCTCGGGACGGTATTTCATCTTTCCACCTCCATCTATATCCATTCCGGGTTCA
ATAAGTGGTCTAACGAGTGTCTGTTTTGGTTTTTCTATAGTCGTACGTGAAAGGAGCACACTTTCTAACCCAAGA
TGCCTCCCAATTTGATGCGTCGTTTTTCAACCTCTCTTCCGAAACGGCTAGTGTAAGGGCACCATTCCACCCTGA
CATTTTTCTTGCAAACTGACGAGACCAGGCAATGGACCCGGAGGTCAGAATGCAACTGGAAACGGTATACGAGGC
GTTGGAGAATGCCGGCATTCCCCTCGAACAGGTGGCGGGCTCGCGAACGGCCGTGTTTGCAGGGACCTGCTTTCG
AGATAATCACGACAGCTTAATGCGAGACCCAGACACCCTTGCGCGCTTCTATTTGACAGGGAATGGGGCGGCCAT
GATTGCAAACCGGGTATCCCATTTCTATGATCTACGAGGCCCCAGTCTCATGATCGACACCGGCTGCTCCACCAC
TCTCACCCTACTTCATCTAGCCTGCCAGAGCCTGCGAGCTAACGAGAGCAACATGGCCATCGTAGGGGGATCGAA
TGTTCTCCTGAACCCGGATATGTTTATTTCCGGAACCAACCTCAGGTACGTTCAGACTTGAACAGGGAAGGAACG
TGAGAGAGAAATTTCTGACAAGAATTAGTCTTCTCTCCGCGGAAGGAAAGTGCTTTGCTTTTGACTCCCGGGCAT
CGGGGTATGGTCGCGGGGACGGCGTGGCCACCATCCTAATTAAGCCCCTGGAGACGGCCCTCCGCGACGGCGATC
CCATTCGCGCGGTGATCCGCAATACCGCCGCTAACCAGGATGGGAAAACGGCCACCCTGACGTCACCGAGCCAGG
AGGCACAGCAGACGCTCATGCGGGAATGCTATGAAGTGGCGGCTCTAAACCCCGTTGATACGGCCTATGTCGAGG
CCCACGGGACCGGGACCCAGGCTGGAGACACCATTGAAGCGCATGCACTGGGCACGGTCTTTGGCAATGGCCGAC
CCGGGGAACACCCGCTTCTGATCGGATCGGTCAAGACGAACATTGGCCATACGGAAGCGGCAAGTGGTCTTGCAG
GTATTATCAAGGCGGTCATGGCATTAGAGAAGGGGAAAATCCCACCGCATTTGAACTATGAGTCCCCCAACGAGA
AGATCTCGCTGGAGACTTTGAAACTAAAGGTAGGCCAAAGCAATCCATTTTGACTCGTGGCGCCTATGGATACCA
ATCACTGATCCCATACCTTGGATAGATCCCGCTCAGCCTGCAGTCATGGCCCTCACACTCGCTACGTCGAGCGTC
GATCAATAACTTCGGCTATGGAGGCGCCAATGCACACGCTATCCTCGAACACCCACAATATCTCCTTCCTCTCTT
GGCCCCGTCGACAGAGCTATGCTCCCCGAATCCCAAGGCCCGGTCTCGAGTGTTCGTGCTCAGCGCCAAAGACCA
ACAGACGACCCGGACCATGGTCGACCAACTGCGACAATATGTTTCAGAGGCAGGAGAACGATCCGAGTCGAAAAA
TGACCATCTCATGGATCAACTGGCACTTACACTAGGGCAACGACGGTCCCGGTTTGCATGGACAGTGGCCTGCCA
AGCAGACTCGCTGGCCGCCCTGCAGTCGACGCTTGACTCCACACAGCTGTCTCCCCATCGCAGTTCGCGGGCTCC
CCGGCTGGGAATGATTTTCACTGGCCAAGGTGCCCAGTGGCACGCCATGGGACGGGAGCTCTTAAGCGCCTATCC
TGTCTTTTGGCAGACTATCGGGGAGGTGGATGAATGCCTCCGCTCTATGGGAGCAAGCTGGTCGGTGGTCGAGGA
GTTGCAGCGCGATGCCAACGAGAGCCGCGTCAATCAAGTCTCCCATAGCCTGCCGCTGTCGGTCGCGGTCCAAAT
CGCCCTAGTCAATCTCCTCCGATCCTGGGGCATTCACCCCACCGGAGTCACCGGCCATTCGAGCGGAGAGGTTGG
CGCTGCATATGCCGCCGGGGCTATCAGCCTGTCGGCCGCCATGGCCATCGTCTACAGCCGGGGCGATCTGACCAG
TCAGTTTCAAAGGCTGCTCGACCGTGCAGGCGGGATGGTGGCCGTCGGTCTGGGTCGCGAGAATGCCCAAGCCGT
GCTCTCCCGGGTTCAATCTGGGAAAGCCGTCATTGCGTGCGTCAACAGCCCATCCAGCGTGACTATCTCGGGCGA
TATGATCGCTATTGAGGAGATAGAGGCAATTCTAGCGCAAGAGCAGGTGTTTGCTCGCCGCCTAAAGGTCGAAGC
GGCTTATCACTCTCACCATATGCTGCCCATTGCCGACGACTATAGGGAAATGTTGTCCCGGTTCTTGCAGCCAGA
ACCCGGTTATGACGGGGGAATTACCTACTCATCCCCGACGACAGGCGATCGTATGTACTCCGGAGAAGAAATCGC
GAGTCCAGAGCACTGGGTACGAAACATGGTACAGCCTGTGGAGTTTCTCGACGCCCTTCGCAACCTCTGTGTTAA
TCCGGCGGAGACTGATGGCACGCCCGCGGTTGATCTGCTCATCGAAGTCGGGCCGCACGGCGCTCTGGCCGGTCC
GGTCCGACAGACCCTTCAGCTCCCAGAGCTACAGCCAGCGGGAATCGCTTACGAGTCGTGCTTGACAAGGGGGGA
GAATGCCGTGCAGACCATGCACCGTCTGGTCTCGTCGTTAGTCAAACAAGGCTATCCGGTGGATCTCGGGGCGGT
CAATTTCCCTTACAGCCACCAGGGAATACCGATGCTCACCGATCTGCCGACATATCCATGGAATCACGAGACGTC
CTACTGGACTGAACCACGCATGAACCGTGACCTGCGGACAAGGACTTTCGCACCCCACGATCTATTGGGCGTTGC
CGCCGCCGATTCCACCCCTTCAACACCCAGCTGGCGCTATGTCATTCGTCCTCGGGACGTTCCCTGGGTGCGAGA
TCACGTCGTCCAGGGGTCCATTATTTATCCCGGAGCGGGCTACATCAGTATGGTCGTGGAGGGTCTGCGTCAACT
TGGTGGCGGTGAATTCTCGCTAACTCCATCGGGGTACCAGCTGCAGGATGTTCAGATCCGCAATCCGCTCATCCT
CGACGATACATCGGCCGCCGGAGTCGAGGTTCGCACATCCATGCGCCCCACGGCCGACGGAGTCCTTCGGGTCCA
GGGCTGGTATGACTTCCAGATCCAGTCGGTTGATACTCAGGGCAAGTGGACTATTCACTGTGAGGGTCAGTGTGC
AACTATCGCACCACATAACGGAAGTGGATGGGTTGGCCCGGCTTTCGTCGATTCGGGGATTGATAATCAAGCAGA
GCAAGGGAACTGGAGAACAATTGATCCGGCGGATACATACAAGGCATTGCACGCCGTAGGCGTGAATCACGGCCC
GATATTTCAGAACTTGATCGCTGCGCAATCGATGCCTGGGCACTCTATCTCAACATTCAAAGTGGCTGATACGGC
TGACTCCATGCCGCACCGCCATCAACAACCCCATCTCATACAACCGACCACCCTGGACTCGGTTTTCCAGGGGGT
ATACCATAACCTACCCTCCGGAGGAACGGACCAACGAACGGCCCTGATTCCGACCGCTATCAAGTCATTGTACAT
TGCGTCTTCGTTGAGTGCAGAGCCTGGACACATTTTTGAGTCTCATTCGTCCCTCATCCGGTCCGGTCCTCACGG
ATTTGAGTCCTCTGTCCGGCTCGTCGATGCAACCACCCCCGGTCCCCATCGGGAGCCGGTACTGAGGATCGAGGG
ATTATTCTTTCGGTCACTGGGCGGGACAGCTACGATTGATGAGCCGCATGACAACCTCTGTTACCAGGCTATCTG
GAAACCAGACGTGGACTTTGTCACTGCCGCCGATCTGCGTCCCTCCCAAGCTTCTAATCTCGGTGCCAAACAGCT
CAAATTCTCGCGACTCCAGGAGATGGCCGTTGTCTTTCTTTCTGCAGTGCTCCGCGAGATTAAAGAAGAGACTGT
CACGGCAGACAATCAAGCTTATTGGACTTGGATGAAGAGCGTCGTCGACGAGGCTCGGCCCACACTAGACCTCGA
TGGCATGAGCGCGGAATACGTCCTGGCGCTGGCGTCGGACCTGGAAGAGGTCGAGGAAGGAAGGCTTCTCACCCG
ATTTGCTCGAGCATTACCTGATATCCTTTCTGGACAAACGGACGCTCGAATCGTGGCTGAGCATTGTCACTTCGA
ACTTCTGGAAAGGTCTTCATCTCAGCCAGCTGACTTTTGCGTCTCTGTTGTCCAGGACCTGCTAGGTCTGTACAG
CTACAAGTCACTCCAGTCCAAGATTCTTGAAATCAGCAATGGCAGTTTCCAGACGACCCGTATGATACTAGATGC
ATTGACAGCAGGCACGGACCGAGGTTTCAGTGACTACGATATGGCGACTCTGGAGCTGCAAGAGGCACGGGCTAC
AACAGATGAGGATGCATTGAAGGATTATGATGGGCGAGTTCACTTCAAGACCTACACCCCTAGCGAGTTTCCAGA
GGATCAAGGCTTTAGTCCTGAGACATACGATTTAATCATTCTATCCTCTGCGCTGTGTATCACTGGGGACGTTGA
ACAGATTCTCAAGAATGTTCGAACCTTGCTCAAGCCGGGAGGCAAATGTCTGATATTTGGACACAGCATTCAGGA
TTCTGCAATCCAGGTTATCCTGAGGCTGATGCCGCAATGGAAGGGAGTCACCTCCCTCGAATCGTGGAAGGGCCC
ACTCGAGCGAGCTGGATTGGACCCCTGCGCCCTTCAGGTTGTACAGGGCCTCGATGCCGAATCATATCGAGGTGA
AGTAATTTTGGCTTCAATTCTTCCACCGGAGGTGGCGAAGGAACTGCCATCATCACGCCAGATCATGTTGGTGTA
CTCCACAGCTGCACCGCCGGAGAGCTGGGTACAGTCCCTCAGGGCCACCCTTCATCAACACGGTTCCTACAGTTT
GTCGGTTCACTCCTTGGAAGAGGCGGTCAACGTTGAGAGTGGTGTTTGTGTCTTCCTCGATGATCTGGTTAGCCC
TCTTCTCCATAATCTCACTCAGGATCAGTTCAACGCCCTGCGCCATTTGTTGGGCTTCTCCCAGGGCTCCTTATG
GGTATCTCGGGGGGCCCAAGCGATTACGGAGGAGCCGTGGGGTGCTCTCCATCAGGGTTTGTTACGGACCCTCCG
ATGTGAGAACACTGCCAAGCGCTATGTCTCCTTGGACCTGGCTCCGGAATCTGCGGCATGGAGTGCACACTCGGC
CGATGTGGTCGCACGTATCCTACACGTCGGCTTTTATCTTTCGCCCCATAACAAACTGGAAACGGAATATTCTGT
TCGATCCAATGTAGTCCACATTTCACGTGTTTGCGAAAACGTGCACGAAACCCAGCTCGTCTCTGGTCTCTCTCT
GCGGAGAGAACCGGAGCTCAAGCCCTTCTTTGAGATCGGCCATCCAGTTCGCCTCGGAGTGACCACTCCGGGTCT
CCTTAGCAGCCTGGAATTTGGCCATGATCCTTTGGCGAATGAGCCGCTACCTGACGGTTATGTCGAAATCGAGCC
ACGAGCCTTTGGACTCAATTTCCGCGATGTCATGGTTGCCCTGGGTCAGTTGGATGAAATCCGGATGGGATTTGA
ATGTAGCGGAGTCATCGCCCATGTCACTCCTCAAGCTCGCGCGGCCGGTTTCAGGGAAGGGGATTATGTATACGC
CTTTATCATCGGGTACTTTGCCACCCGTGTGCGCATCCCATACACCAGCGTTGCGCCTATCCCCGTGGGTATGGA
TTTCCCCACGGCTGCTTCAGTTCCGCTTGTATTTATTACCGCTTACCATGCCCTTTACGATTTGGCTCATCTGAA
GCCCGGAGAGACTGTTCTCATCCATTCGGGAACCGGTGGAGTCGGGCAAGCGGCCATCATGCTGGCCCAGGCAGC
TGGCGCAGAGATCTTTGTGACCGTTGGGTCGGAGGAGAAGCGAGACTTCATCGCTGAGCACTACGGCATCTCTCC
GTCTCGGATATTCAGCAGTCGAAACGATTCCTTCGTGGATCATATCATGCACGCCACGAACGGAAAGGGAGTCGA
TGTGGTGTTGAACTCCCTCGCCGGCCCTCTTCTCCGCCAGACATGGCGCTGCATTGGCACCTTTGGTCGTTTCAT
CGAAATTGGAAAGAAGGACATTGAGCAGAACAGTATGGTCGAGATGGGGCCCTTCGTCCGCAGTGTTCTCTTTGC
CTCGCTGGACTTGATTACTCTGGGGGAACAGCGTGGACCGGAAGTGGCCCGCATCTTTGGCGAGATCAACACCCT
GCTCGAGGCCGGTCAAATCCGTCCGGTGAGCCCTATTACAACGTTCTCCATGGGCGAGGTGGAGAAAGCCTTCCG
CACGATGCAAACGGGGAAACATATAGGCAAAATCATTTTACAGCCACGGCCCGGCGATATTGTCAAGGTAGGACA
AGTCCTAGGACGAAGTCGCTCTGGAAACTACAGCTAATACATACATCCAGGTCCTGCCGCCCGCTCCCAAACCTA
TTATTCTCTCCCCTAAGGCGAGCTACTTGGTTGTTGGTGGCCTCGGTGGCATAGGAAAATCGGTGGCCCAAATGC
TAGTTGACAGAGGAGCCCGTCATCTCGTCCTGCTCTCCCGCAGTGCCTCGACGCTCGATCATTCTAGGAAAGCGT
TTGTCCGCTCTCTTGAAGCCCATGGCACGACCGTTACCCTGCACAGCTGCGACATCGCCGATAAGAGTCAGCTGA
TGGCTGTTTTTGCAGACTGTGCTCGCCGCATGCTACCGGTGAAGGGGGTCATCCAAGCGGCCATGGTTCTCAAGG
TAAGTCAACGGCCAACAACAGACCGACCGATGTTTCCAGTTTTTCACTCCCGCTAACCGCCTTGGATAGGACTGC
ATCTTTGAACAGATGAAGTGGGCTGATTACATGGCCGCCCTCCGTCCGAAGGTCCAGGGCAGCTGGAATCTTCAT
GAACTGTTGCTGGATGCGGATTTCTTCGTCCTTCTCTCCTCGATCAGCGGCTTTGGAGGAAATGCGGGACAGGCG
AACTACGCTGCCGGGGGGAGCTTTCAAGATGCTCTCGCCCGACATCGCGCGGCACAGGGCCTATCTGCTGTGTCA
ATTGATCTGGGAATGGTCTCGTCTGTAGGTGTGGTCGCAGGGACGCAGCGAGTTGCAGACCATCTCACCAAACTG
GGGCTGCGAGCTGTGTCTGAACAGGAAGTCCTGGGCCTGGTCGAATCCGCGATCCGGGATCCCCGTCGAACATCC
ACAACATGCCAGGTAGTCACAGGCATCCCGTCCACGTTTACCCGGTCTGATTCAGCTGCATTCTGGAATCATGAT
ACCCGTTTTGCTGGGTTAGAACAGCGCGGTGACCTCACCGGTTCCGGGGAAGGCTCCGCCGGTCCTGACGGTAGC
GGGCCCAACATCAAGAAGCAGCTTACCGCGTCGACGACGTTGCTTGAGGCCGTCCAGACCATCACACACGCCCTG
GTCGGGATTCTCGCAGGCATGTTTAGCAGGCCGGTGTCGGAAATAGACCCCAACATGTCGCTTTCGCAGTTTGGT
GTGGATTCATTAGTGGCGGTTGAGCTGCGCAATTGGCTGGTGGCCACATTCGAGGCCGAGTGCTCTCTTTTCGAC
GTGATGCATAGCTCCTCAGTGACCGCATTGGCGACCCTTGTGGCACACAAAAGTAAACTGGTGTGTGTCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail