Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g2985.t1
Gene name
Locationscaffold_03:489748..491657
Strand-
Gene length (bp)1909
Transcript length (bp)1608
Coding sequence length (bp)1608
Protein length (aa) 536

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 6.5E-60 5 407

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 174 196 22
2 209 231 22
3 274 296 22
4 348 370 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g2985.t1
MWRRTYLLLLVIRVYFALSPSYLHPDENFQGPELFAGRIFSFPSKIPWEFTVEHPIRSIFPIWAAYELPMNLLKW
FYTETGEGSPPPHMIYNALRGGMFLLSFVLEDWAIYELVPSPRHRRATVVLVASSYVTWTYQTHTFSNSLETLLV
AWGLVLIRRIVNNKRHSSFFSHAVLAFIAVVGVFNRITFPAFLLFPGLQLLPQFQRKPLGLAAFLLFGLFFSFIA
IYTDTIFYRPTASFLSVFRHPIITPLNNLLYNTDTANLAQHGLHPHYQHFTANLLQLLGPAYIAMIVSLFSRPLI
PYWMRNVRALSALSATMLLSLFPHQEPRFLLPVVPLLLSCFPMRGSRLLVVVWVIFNAAMGFLMGVYHQGGVVPT
QLAMRDIVSSSPTPYIPSATVFWWKTYSPPLWLLGGDDQSTEIQTLDLMGMSGVDMIQQLELVVPGCSTPSPVFL
VAPTSATFLDQYVFSAPQSQDQDQDQDQDQAQAQNQTLQLHQLWSYRNHLNLDDMDFGDDGILPTLKRVVGRRGL
DVWSVQRSCK*
Coding >Pro_DTO070G2_2|g2985.t1
ATGTGGCGTCGAACATATTTACTGTTGTTGGTGATTCGGGTGTACTTTGCGCTGTCTCCAAGCTATCTACATCCT
GATGAGAATTTCCAAGGTCCAGAGCTTTTCGCAGGTCGCATATTCTCATTTCCGTCGAAGATACCATGGGAATTC
ACCGTTGAACACCCCATTCGCAGCATATTCCCAATATGGGCGGCCTACGAGCTTCCAATGAACCTCTTGAAATGG
TTCTATACCGAGACCGGCGAGGGCAGCCCCCCACCCCACATGATTTACAATGCGCTGCGCGGTGGAATGTTCCTA
TTAAGTTTTGTCCTCGAGGACTGGGCGATCTATGAGCTAGTGCCTTCTCCGCGTCATCGGCGCGCGACAGTGGTG
CTGGTGGCCTCATCGTATGTCACCTGGACGTATCAGACGCACACATTTTCCAACAGCCTCGAGACCCTGTTGGTT
GCCTGGGGGCTGGTTTTGATTCGGCGCATTGTCAACAATAAGCGACACTCGTCCTTCTTCTCCCATGCCGTGCTT
GCCTTCATCGCCGTAGTGGGCGTCTTCAACCGCATCACTTTCCCGGCTTTCCTTCTCTTCCCGGGTCTGCAATTG
CTGCCTCAGTTCCAGCGCAAACCACTCGGGCTCGCAGCATTCCTCCTCTTCGGTCTCTTCTTTTCCTTCATCGCC
ATCTACACAGACACGATCTTCTACCGGCCAACTGCCTCCTTCCTCAGCGTTTTCCGCCACCCCATAATAACTCCC
CTCAACAACCTCCTCTACAACACCGACACTGCCAACCTAGCCCAGCACGGCCTCCACCCCCACTACCAACACTTC
ACTGCAAACCTCCTCCAACTCCTCGGCCCAGCCTACATTGCAATGATAGTCTCCCTTTTCAGCCGGCCGCTAATA
CCATACTGGATGCGCAATGTGCGCGCCCTCTCCGCGCTCTCTGCAACGATGCTCCTCTCCCTCTTTCCGCACCAA
GAACCACGCTTCCTCCTCCCAGTCGTGCCCCTCCTCCTCAGCTGCTTCCCCATGCGCGGCTCCCGCCTCCTCGTT
GTTGTATGGGTCATCTTCAACGCAGCCATGGGCTTCCTTATGGGCGTCTACCACCAAGGCGGCGTCGTTCCCACG
CAGCTAGCAATGCGCGACATCGTCTCATCTAGTCCAACACCGTACATACCATCCGCAACGGTGTTCTGGTGGAAG
ACATACTCCCCACCGCTGTGGCTTCTCGGTGGAGACGACCAGTCCACAGAAATCCAGACGCTGGATCTCATGGGC
ATGTCAGGTGTGGATATGATCCAGCAGCTGGAGCTGGTTGTACCCGGCTGCTCTACTCCATCGCCTGTGTTCCTA
GTCGCGCCTACATCGGCTACTTTCCTCGATCAATACGTCTTCTCTGCGCCTCAGAGCCAAGACCAGGACCAAGAC
CAAGACCAAGACCAAGCCCAAGCCCAAAACCAAACTTTGCAGCTCCATCAACTGTGGTCGTATCGCAACCACCTC
AACCTCGATGACATGGACTTCGGCGACGACGGGATCCTGCCGACTCTGAAACGGGTCGTTGGACGCCGTGGGCTG
GATGTTTGGTCTGTGCAGAGATCTTGCAAATAA
Transcript >Pro_DTO070G2_2|g2985.t1
ATGTGGCGTCGAACATATTTACTGTTGTTGGTGATTCGGGTGTACTTTGCGCTGTCTCCAAGCTATCTACATCCT
GATGAGAATTTCCAAGGTCCAGAGCTTTTCGCAGGTCGCATATTCTCATTTCCGTCGAAGATACCATGGGAATTC
ACCGTTGAACACCCCATTCGCAGCATATTCCCAATATGGGCGGCCTACGAGCTTCCAATGAACCTCTTGAAATGG
TTCTATACCGAGACCGGCGAGGGCAGCCCCCCACCCCACATGATTTACAATGCGCTGCGCGGTGGAATGTTCCTA
TTAAGTTTTGTCCTCGAGGACTGGGCGATCTATGAGCTAGTGCCTTCTCCGCGTCATCGGCGCGCGACAGTGGTG
CTGGTGGCCTCATCGTATGTCACCTGGACGTATCAGACGCACACATTTTCCAACAGCCTCGAGACCCTGTTGGTT
GCCTGGGGGCTGGTTTTGATTCGGCGCATTGTCAACAATAAGCGACACTCGTCCTTCTTCTCCCATGCCGTGCTT
GCCTTCATCGCCGTAGTGGGCGTCTTCAACCGCATCACTTTCCCGGCTTTCCTTCTCTTCCCGGGTCTGCAATTG
CTGCCTCAGTTCCAGCGCAAACCACTCGGGCTCGCAGCATTCCTCCTCTTCGGTCTCTTCTTTTCCTTCATCGCC
ATCTACACAGACACGATCTTCTACCGGCCAACTGCCTCCTTCCTCAGCGTTTTCCGCCACCCCATAATAACTCCC
CTCAACAACCTCCTCTACAACACCGACACTGCCAACCTAGCCCAGCACGGCCTCCACCCCCACTACCAACACTTC
ACTGCAAACCTCCTCCAACTCCTCGGCCCAGCCTACATTGCAATGATAGTCTCCCTTTTCAGCCGGCCGCTAATA
CCATACTGGATGCGCAATGTGCGCGCCCTCTCCGCGCTCTCTGCAACGATGCTCCTCTCCCTCTTTCCGCACCAA
GAACCACGCTTCCTCCTCCCAGTCGTGCCCCTCCTCCTCAGCTGCTTCCCCATGCGCGGCTCCCGCCTCCTCGTT
GTTGTATGGGTCATCTTCAACGCAGCCATGGGCTTCCTTATGGGCGTCTACCACCAAGGCGGCGTCGTTCCCACG
CAGCTAGCAATGCGCGACATCGTCTCATCTAGTCCAACACCGTACATACCATCCGCAACGGTGTTCTGGTGGAAG
ACATACTCCCCACCGCTGTGGCTTCTCGGTGGAGACGACCAGTCCACAGAAATCCAGACGCTGGATCTCATGGGC
ATGTCAGGTGTGGATATGATCCAGCAGCTGGAGCTGGTTGTACCCGGCTGCTCTACTCCATCGCCTGTGTTCCTA
GTCGCGCCTACATCGGCTACTTTCCTCGATCAATACGTCTTCTCTGCGCCTCAGAGCCAAGACCAGGACCAAGAC
CAAGACCAAGACCAAGCCCAAGCCCAAAACCAAACTTTGCAGCTCCATCAACTGTGGTCGTATCGCAACCACCTC
AACCTCGATGACATGGACTTCGGCGACGACGGGATCCTGCCGACTCTGAAACGGGTCGTTGGACGCCGTGGGCTG
GATGTTTGGTCTGTGCAGAGATCTTGCAAATAA
Gene >Pro_DTO070G2_2|g2985.t1
ATGTGGCGTCGAACATATTTACTGTTGTTGGTGATTCGGGTGTACTTTGCGCTGTCTCCAAGCTATCTACATCCT
GATGAGAATTTCCAAGGTCCAGAGCTTTTCGCAGGTATGTTCAACTATCCAATGATCGCCCCACCAATCGCGATC
ATACTGCGACTATACGGACGCGAGGAACTCTTTGTTGCGATTTTCCCTAAAGCAGAAAGCAAAACAGCGCGATCC
GGCAATTCCGCGACTCTCCTATACGAAGAACAAACATTGACCAAGTCGCCTGAATACAGGTCGCATATTCTCATT
TCCGTCGAAGATACCATGGGAATTCACCGTTGAACACCCCATTCGCAGCATATTCCCAATATGGGCGGCCTACGA
GCTTCCAATGAACCTCTTGAAATGGTTCTATACCGAGACCGGCGAGGGCAGCCCCCCACCCCACATGATTTACAA
TGCGCTGCGCGGTGGAATGTTCCTATTAAGTTTTGTCCTCGAGGACTGGGCGATCTATGAGCTAGTGCCTTCTCC
GCGTCATCGGCGCGCGACAGTGGTGCTGGTGGCCTCATCGTATGTCACCTGGACGTATCAGACGCACACATTTTC
CAACAGCCTCGAGACCCTGTTGGTTGCCTGGGGGCTGGTTTTGATTCGGCGCATTGTCAACAATAAGGTGGGAGA
GATAAAGCTCCAAAGCGCACCATCCATGCTAACCTTAGCTCCAGCGACACTCGTCCTTCTTCTCCCATGCCGTGC
TTGCCTTCATCGCCGTAGTGGGCGTCTTCAACCGCATCACTTTCCCGGCTTTCCTTCTCTTCCCGGGTCTGCAAT
TGCTGCCTCAGTTCCAGCGCAAGTGCGTCAATATACATACATTTTACCTCCAGCTCATCCATCAATACACATGTG
CTAACCCCGCCTTCGCGCCAGACCACTCGGGCTCGCAGCATTCCTCCTCTTCGGTCTCTTCTTTTCCTTCATCGC
CATCTACACAGACACGATCTTCTACCGGCCAACTGCCTCCTTCCTCAGCGTTTTCCGCCACCCCATAATAACTCC
CCTCAACAACCTCCTCTACAACACCGACACTGCCAACCTAGCCCAGCACGGCCTCCACCCCCACTACCAACACTT
CACTGCAAACCTCCTCCAACTCCTCGGCCCAGCCTACATTGCAATGATAGTCTCCCTTTTCAGCCGGCCGCTAAT
ACCATACTGGATGCGCAATGTGCGCGCCCTCTCCGCGCTCTCTGCAACGATGCTCCTCTCCCTCTTTCCGCACCA
AGAACCACGCTTCCTCCTCCCAGTCGTGCCCCTCCTCCTCAGCTGCTTCCCCATGCGCGGCTCCCGCCTCCTCGT
TGTTGTATGGGTCATCTTCAACGCAGCCATGGGCTTCCTTATGGGCGTCTACCACCAAGGCGGCGTCGTTCCCAC
GCAGCTAGCAATGCGCGACATCGTCTCATCTAGTCCAACACCGTACATACCATCCGCAACGGTGTTCTGGTGGAA
GACATACTCCCCACCGCTGTGGCTTCTCGGTGGAGACGACCAGTCCACAGAAATCCAGACGCTGGATCTCATGGG
CATGTCAGGTGTGGATATGATCCAGCAGCTGGAGCTGGTTGTACCCGGCTGCTCTACTCCATCGCCTGTGTTCCT
AGTCGCGCCTACATCGGCTACTTTCCTCGATCAATACGTCTTCTCTGCGCCTCAGAGCCAAGACCAGGACCAAGA
CCAAGACCAAGACCAAGCCCAAGCCCAAAACCAAACTTTGCAGCTCCATCAACTGTGGTCGTATCGCAACCACCT
CAACCTCGATGACATGGACTTCGGCGACGACGGGATCCTGCCGACTCTGAAACGGGTCGTTGGACGCCGTGGGCT
GGATGTTTGGTCTGTGCAGAGATCTTGCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail