Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g2962.t1
Gene name
Locationscaffold_03:415887..417818
Strand+
Gene length (bp)1931
Transcript length (bp)1875
Coding sequence length (bp)1875
Protein length (aa) 625

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12929 Mid1 Stretch-activated Ca2+-permeable channel component 9.8E-158 164 597

GO

GO Term Description Terminal node
GO:0098703 calcium ion import across plasma membrane Yes
GO:0005262 calcium channel activity Yes
GO:0009987 cellular process No
GO:0030001 metal ion transport No
GO:0022857 transmembrane transporter activity No
GO:0098655 cation transmembrane transport No
GO:0046873 metal ion transmembrane transporter activity No
GO:0099587 inorganic ion import across plasma membrane No
GO:0097553 calcium ion transmembrane import into cytosol No
GO:0070588 calcium ion transmembrane transport No
GO:0015267 channel activity No
GO:0034220 ion transmembrane transport No
GO:0006810 transport No
GO:0022803 passive transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0006816 calcium ion transport No
GO:0051179 localization No
GO:0098660 inorganic ion transmembrane transport No
GO:0005215 transporter activity No
GO:0098739 import across plasma membrane No
GO:0098662 inorganic cation transmembrane transport No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0005261 cation channel activity No
GO:0005216 ion channel activity No
GO:0055085 transmembrane transport No
GO:0006812 cation transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0015085 calcium ion transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0098657 import into cell No
GO:0098659 inorganic cation import across plasma membrane No
GO:0008150 biological_process No
GO:0022890 inorganic cation transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g2962.t1
MRRQYNALQCYLTATISAIFLLFAVTVTYADASDVPGTENTLSLQGAVPSDGAGFPLALDSFNGLELRDSVDEDG
ESNGLELVRRYPNVAKALGNNQFEAPGALEIGAVQWFYLPSAVVNGKHDPKGVGLPAYVNSTNEDDDDDDSTYEL
RKRDGDFSKRATTTVYLSLTTCQKPSTNKTDLQGEFPQLQMYVSTSQKLQQPGPGKDDSLQDMHTAVGGYIGITL
DTNTDVFVGIAAPNSTDYTGYYTYQVAASIDAFFHNIVDDDPNLFFIDADTSAALLVTNNLTQSAKNSTNYQQWM
DIVPPYTMFAHNINDTALQGLEKSFCALDALSQVGRISSSTEVGMTNRGLGNKPKEQFYITGLNRSSSYSGLLAM
VGNSTTSGNGIIGGGGKVWRPMNFTTKAEENCAVLFNLTFCSEVAYAVPSNPKLSVDKLRTIYDDYAAAFYQNFT
YSLQQIQCKTSEESMFSLAVDCDDCAKAYKQWLCGVTIPRCADYSSNATYLAVRNAGQAFINGSSLPDDSPYRQS
VASNTSRNPIIDEQIMPGPYKEILPCQDICHTLVKDCPSALGFGCPQGAWMNSSYGYRNSEGIITCSYLGAVYYL
SLGEKLGASGWVTSLVVMGIMYLL*
Coding >Pro_DTO070G2_2|g2962.t1
ATGCGACGCCAATACAACGCGCTGCAGTGCTATCTTACTGCAACGATTAGCGCGATCTTCCTTCTTTTCGCTGTC
ACGGTCACCTATGCCGATGCATCCGATGTCCCGGGTACAGAGAACACCTTGAGCCTCCAGGGGGCGGTTCCCAGC
GACGGGGCAGGATTCCCACTTGCGCTGGACTCGTTCAATGGGCTAGAACTTCGCGACAGTGTCGACGAAGATGGC
GAGTCAAATGGGCTAGAGCTCGTGCGCAGATACCCTAATGTCGCGAAAGCATTGGGCAACAATCAGTTCGAGGCG
CCGGGCGCGCTCGAGATCGGCGCTGTCCAGTGGTTCTATCTGCCCTCGGCTGTGGTGAACGGCAAACACGACCCG
AAAGGCGTGGGTCTTCCTGCATACGTGAATTCTACAAATGAAGACGACGATGACGATGACTCGACCTATGAGCTA
CGGAAACGAGACGGGGACTTCTCGAAGCGAGCGACGACTACGGTCTACTTGTCGCTCACGACCTGCCAAAAACCA
TCTACCAACAAGACCGACCTACAAGGCGAGTTCCCGCAGTTGCAGATGTATGTGTCGACTTCGCAGAAATTGCAA
CAGCCAGGACCGGGCAAAGACGATTCGCTGCAGGATATGCACACTGCCGTTGGCGGGTATATTGGAATCACCTTA
GATACGAATACCGACGTCTTCGTCGGCATCGCAGCGCCCAATTCAACCGACTACACAGGATATTACACGTACCAG
GTCGCAGCATCTATCGATGCCTTTTTCCACAATATCGTGGACGATGACCCGAATTTGTTCTTCATCGACGCGGAC
ACGTCGGCCGCGCTGCTGGTGACGAACAACTTGACTCAGTCTGCGAAGAATTCGACAAACTACCAGCAATGGATG
GACATCGTCCCTCCGTATACTATGTTTGCCCACAATATCAACGATACGGCACTGCAGGGCTTGGAGAAATCATTC
TGCGCTCTCGATGCGCTTTCGCAGGTGGGCCGAATAAGTAGTTCAACCGAGGTTGGCATGACCAATCGCGGACTT
GGGAATAAGCCCAAGGAACAATTCTATATCACTGGACTAAACCGAAGTTCATCGTACAGCGGTCTTCTGGCAATG
GTGGGCAATTCGACCACGTCCGGAAATGGCATCATCGGCGGCGGCGGTAAGGTATGGCGACCGATGAATTTTACG
ACCAAAGCAGAGGAGAACTGCGCCGTGCTATTCAACTTAACCTTCTGCTCAGAAGTCGCATACGCAGTCCCCTCC
AACCCCAAACTAAGCGTCGACAAGCTCCGCACAATCTACGACGACTACGCCGCCGCCTTCTACCAGAACTTCACC
TATTCCCTCCAACAAATCCAATGCAAAACAAGCGAAGAATCGATGTTTTCCCTCGCCGTGGACTGCGACGATTGC
GCAAAAGCCTATAAGCAATGGCTCTGCGGCGTCACAATTCCTCGCTGCGCAGACTACAGTAGCAACGCCACGTAC
CTAGCCGTCCGTAACGCAGGCCAGGCCTTCATCAATGGCTCTTCCCTGCCGGATGACAGTCCGTACCGCCAGTCC
GTGGCGTCGAATACATCCCGCAACCCTATCATCGATGAGCAGATCATGCCGGGTCCCTATAAGGAGATCCTTCCC
TGTCAGGATATCTGTCATACCCTTGTTAAGGATTGTCCGTCTGCCCTTGGCTTCGGGTGTCCTCAGGGCGCGTGG
ATGAATTCTTCCTATGGCTATCGGAATTCAGAGGGTATTATTACCTGCTCTTATCTCGGGGCTGTGTATTATTTG
AGTCTTGGGGAAAAGCTGGGGGCTAGCGGTTGGGTGACTAGCTTGGTGGTTATGGGAATTATGTATTTGCTGTAG
Transcript >Pro_DTO070G2_2|g2962.t1
ATGCGACGCCAATACAACGCGCTGCAGTGCTATCTTACTGCAACGATTAGCGCGATCTTCCTTCTTTTCGCTGTC
ACGGTCACCTATGCCGATGCATCCGATGTCCCGGGTACAGAGAACACCTTGAGCCTCCAGGGGGCGGTTCCCAGC
GACGGGGCAGGATTCCCACTTGCGCTGGACTCGTTCAATGGGCTAGAACTTCGCGACAGTGTCGACGAAGATGGC
GAGTCAAATGGGCTAGAGCTCGTGCGCAGATACCCTAATGTCGCGAAAGCATTGGGCAACAATCAGTTCGAGGCG
CCGGGCGCGCTCGAGATCGGCGCTGTCCAGTGGTTCTATCTGCCCTCGGCTGTGGTGAACGGCAAACACGACCCG
AAAGGCGTGGGTCTTCCTGCATACGTGAATTCTACAAATGAAGACGACGATGACGATGACTCGACCTATGAGCTA
CGGAAACGAGACGGGGACTTCTCGAAGCGAGCGACGACTACGGTCTACTTGTCGCTCACGACCTGCCAAAAACCA
TCTACCAACAAGACCGACCTACAAGGCGAGTTCCCGCAGTTGCAGATGTATGTGTCGACTTCGCAGAAATTGCAA
CAGCCAGGACCGGGCAAAGACGATTCGCTGCAGGATATGCACACTGCCGTTGGCGGGTATATTGGAATCACCTTA
GATACGAATACCGACGTCTTCGTCGGCATCGCAGCGCCCAATTCAACCGACTACACAGGATATTACACGTACCAG
GTCGCAGCATCTATCGATGCCTTTTTCCACAATATCGTGGACGATGACCCGAATTTGTTCTTCATCGACGCGGAC
ACGTCGGCCGCGCTGCTGGTGACGAACAACTTGACTCAGTCTGCGAAGAATTCGACAAACTACCAGCAATGGATG
GACATCGTCCCTCCGTATACTATGTTTGCCCACAATATCAACGATACGGCACTGCAGGGCTTGGAGAAATCATTC
TGCGCTCTCGATGCGCTTTCGCAGGTGGGCCGAATAAGTAGTTCAACCGAGGTTGGCATGACCAATCGCGGACTT
GGGAATAAGCCCAAGGAACAATTCTATATCACTGGACTAAACCGAAGTTCATCGTACAGCGGTCTTCTGGCAATG
GTGGGCAATTCGACCACGTCCGGAAATGGCATCATCGGCGGCGGCGGTAAGGTATGGCGACCGATGAATTTTACG
ACCAAAGCAGAGGAGAACTGCGCCGTGCTATTCAACTTAACCTTCTGCTCAGAAGTCGCATACGCAGTCCCCTCC
AACCCCAAACTAAGCGTCGACAAGCTCCGCACAATCTACGACGACTACGCCGCCGCCTTCTACCAGAACTTCACC
TATTCCCTCCAACAAATCCAATGCAAAACAAGCGAAGAATCGATGTTTTCCCTCGCCGTGGACTGCGACGATTGC
GCAAAAGCCTATAAGCAATGGCTCTGCGGCGTCACAATTCCTCGCTGCGCAGACTACAGTAGCAACGCCACGTAC
CTAGCCGTCCGTAACGCAGGCCAGGCCTTCATCAATGGCTCTTCCCTGCCGGATGACAGTCCGTACCGCCAGTCC
GTGGCGTCGAATACATCCCGCAACCCTATCATCGATGAGCAGATCATGCCGGGTCCCTATAAGGAGATCCTTCCC
TGTCAGGATATCTGTCATACCCTTGTTAAGGATTGTCCGTCTGCCCTTGGCTTCGGGTGTCCTCAGGGCGCGTGG
ATGAATTCTTCCTATGGCTATCGGAATTCAGAGGGTATTATTACCTGCTCTTATCTCGGGGCTGTGTATTATTTG
AGTCTTGGGGAAAAGCTGGGGGCTAGCGGTTGGGTGACTAGCTTGGTGGTTATGGGAATTATGTATTTGCTGTAG
Gene >Pro_DTO070G2_2|g2962.t1
ATGCGACGCCAATACAACGCGCTGCAGTGCTATCTTACTGCAACGATTAGCGCGATCTTCCTTCTTTTCGCTGTC
ACGGTCACCTATGCCGATGCATCCGATGTCCCGGGTACAGAGAACACCTTGAGCCTCCAGGGGGCGGTTCCCAGC
GACGGGGCAGGATTCCCACTTGCGCTGGACTCGTTCAATGGGCTAGAACTTCGCGACAGTGTCGACGAAGATGGC
GAGTCAAATGGGCTAGAGCTCGTGCGCAGATACCCTAATGTCGCGAAAGCATTGGGCAACAATCAGTTCGAGGCG
CCGGGCGCGCTCGAGATCGGCGCTGTCCAGTGGTTCTATCTGCCCTCGGCTGTGGTGAACGGCAAACACGACCCG
AAAGGCGTGGGTCTTCCTGCATACGTGAATTCTACAAATGAAGACGACGATGACGATGACTCGACCTATGAGCTA
CGGAAACGAGACGGGGACTTCTCGAAGCGAGCGACGACTACGGTCTACTTGTCGCTCACGACCTGCCAAAAACCA
TCTACCAACAAGACCGACCTACAAGGCGAGTTCCCGCAGTTGCAGATGTATGTGTCGACTTCGCAGAAATTGCAA
CAGCCAGGACCGGGCAAAGACGATTCGCTGCAGGATATGCACACTGCCGTTGGCGGGTATATTGGAATCACCTTA
GATACGAATACCGACGTCTTCGTCGGCATCGCAGCGCCCAATTCAACCGACTACACAGGATATTACACGTACCAG
GTCGCAGCATCTATCGATGCCTTTTTCCACAATATCGTGGACGATGACCCGAATTTGTTCTTCATCGACGCGGAC
ACGTCGGCCGCGCTGCTGGTGACGAACAACTTGACTCAGTCTGCGAAGAATTCGACAAACTACCAGCAATGGATG
GACATCGTCCCTCCGTATACTATGTTTGCCCACAATATCAACGATACGGCACTGCAGGGCTTGGAGAAATCATTC
TGCGCTCTCGATGCGCTTTCGCAGGTGGGCCGAATAAGTAGTTCAACCGAGGTTGGCATGACCAATCGCGGACTT
GGGAATAAGCCCAAGGAACAATTCTATATCACTGGACTAAACCGAAGTTCATCGTACAGCGGTCTTCTGGCAATG
GTGGGCAATTCGACCACGTCCGGAAATGGCATCATCGGCGGCGGCGGTAAGGTATGGCGACCGATGAATTTTACG
ACCAAAGCAGGTGAGCAAGCCCAAACAATCCATACCAAAAAGTGACTTTATCTAACAATCCTCCAGAGGAGAACT
GCGCCGTGCTATTCAACTTAACCTTCTGCTCAGAAGTCGCATACGCAGTCCCCTCCAACCCCAAACTAAGCGTCG
ACAAGCTCCGCACAATCTACGACGACTACGCCGCCGCCTTCTACCAGAACTTCACCTATTCCCTCCAACAAATCC
AATGCAAAACAAGCGAAGAATCGATGTTTTCCCTCGCCGTGGACTGCGACGATTGCGCAAAAGCCTATAAGCAAT
GGCTCTGCGGCGTCACAATTCCTCGCTGCGCAGACTACAGTAGCAACGCCACGTACCTAGCCGTCCGTAACGCAG
GCCAGGCCTTCATCAATGGCTCTTCCCTGCCGGATGACAGTCCGTACCGCCAGTCCGTGGCGTCGAATACATCCC
GCAACCCTATCATCGATGAGCAGATCATGCCGGGTCCCTATAAGGAGATCCTTCCCTGTCAGGATATCTGTCATA
CCCTTGTTAAGGATTGTCCGTCTGCCCTTGGCTTCGGGTGTCCTCAGGGCGCGTGGATGAATTCTTCCTATGGCT
ATCGGAATTCAGAGGGTATTATTACCTGCTCTTATCTCGGGGCTGTGTATTATTTGAGTCTTGGGGAAAAGCTGG
GGGCTAGCGGTTGGGTGACTAGCTTGGTGGTTATGGGAATTATGTATTTGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail