Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g2811.t1
Gene name
Locationscaffold_03:21753..23725
Strand-
Gene length (bp)1972
Transcript length (bp)1851
Coding sequence length (bp)1851
Protein length (aa) 617

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 2.5E-12 148 412

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g2811.t1
MRLNFLLLAFGLSASLRGVQAETQVDQSVASIWDDFKNTVDCGACQILLGSIKVAAGLGENFMIDVFTGLCKISR
VEDPDVCAGIIKKEGPALHDVFKHLQLNSDASKTLCANLVGLCKQPDVHSYNLTFPSPKPKTVRPPPSGKTPLKV
VHFSDTHVDLLYEPESSYKCSKPICCRSWSDEYSPENTAYPCGPFGNTKCDAPQILQESLHAAIADINPEFSIYT
GDVVAHDIWLVDEAEALKALNATYSAMEKDIGTVYAAIGNHDTAPLNLFPTDASNKADPKWAYSALAEDWYGLTG
VSSVKSADQFASYSAVHPNSNLRIISYNSIFYYVFNFYMYQEPMEKDPRGQFEWLIKELQAAEDAGQRAWLISHI
PSGIPDHFRDHSDYFDQIVQRYEATIAGLFYGHTHRDGFQIAYSDYNDRDWNTATAMGYIIPAVTPTEGSPSFRV
YEIDPVTFGVLDYTQYIANISDPSFQTKPEWLPYYSAKADYGSKISPPLTDPQAEISPAFWHNVTVAMERDPTVF
QDYWARRVRGFEVESCNGDCMKNEICLLRAANAQYNCDKPKSLDFSKLDGQEGEILPEKEPRTSCHHAGMATLIS
KMAHQARLEGRKEPEG*
Coding >Pro_DTO070G2_2|g2811.t1
ATGAGACTCAACTTCTTGCTGCTGGCGTTCGGCCTTTCGGCGTCTCTCCGGGGCGTACAAGCCGAGACTCAAGTC
GACCAGTCCGTCGCTTCTATCTGGGACGACTTCAAGAATACAGTTGACTGCGGTGCTTGCCAAATTCTCCTCGGC
AGCATCAAAGTTGCCGCAGGGCTTGGTGAGAATTTCATGATCGACGTATTCACAGGGTTGTGCAAAATCAGCAGG
GTCGAGGACCCAGATGTCTGCGCCGGGATCATCAAGAAAGAAGGCCCTGCGCTGCATGATGTTTTCAAACATTTA
CAACTGAACTCTGACGCCTCAAAGACACTATGCGCTAATCTGGTCGGGCTCTGCAAGCAACCCGATGTTCATTCC
TATAATTTGACGTTCCCTTCACCCAAGCCAAAGACTGTGAGGCCACCACCTAGCGGCAAGACACCGCTCAAGGTC
GTCCATTTCAGCGATACACACGTGGACCTCCTCTACGAGCCTGAATCTAGCTACAAGTGTTCCAAGCCTATCTGT
TGCAGATCTTGGTCGGATGAATATTCACCAGAGAATACAGCCTACCCATGTGGACCATTTGGAAATACGAAGTGT
GACGCACCACAAATACTTCAGGAGAGCTTGCATGCTGCTATCGCAGACATCAATCCGGAGTTCTCCATTTACACC
GGTGATGTGGTGGCCCACGATATCTGGTTGGTTGACGAGGCCGAAGCTCTGAAAGCGCTCAATGCTACGTACAGT
GCAATGGAAAAGGACATTGGCACTGTGTATGCTGCAATAGGGAATCATGACACTGCACCACTCAACCTCTTTCCC
ACGGATGCTTCGAATAAAGCTGATCCCAAATGGGCGTACTCGGCTCTTGCAGAAGATTGGTATGGCCTCACAGGT
GTTTCTTCTGTCAAATCTGCGGATCAATTCGCGTCGTACTCAGCCGTCCATCCCAACAGCAATCTGCGCATCATT
TCTTATAACAGCATCTTCTACTACGTATTCAACTTCTATATGTACCAGGAACCAATGGAGAAAGACCCACGAGGA
CAATTTGAATGGCTCATCAAGGAACTGCAGGCTGCCGAGGACGCGGGCCAACGTGCATGGCTAATCTCTCATATA
CCATCCGGTATACCAGATCACTTCCGCGACCATTCGGATTACTTCGACCAAATTGTGCAGCGTTACGAAGCCACC
ATCGCGGGATTATTCTATGGTCATACACACCGGGATGGGTTCCAGATCGCATACTCCGACTACAACGACCGAGAC
TGGAACACAGCTACTGCAATGGGTTATATTATTCCAGCCGTAACGCCAACGGAAGGCTCGCCCTCTTTCCGCGTC
TACGAAATTGATCCAGTCACTTTCGGCGTCTTGGATTACACTCAATACATCGCCAACATCAGCGACCCGTCCTTT
CAGACAAAGCCAGAATGGCTGCCCTATTACTCCGCGAAGGCAGACTATGGATCCAAGATCTCTCCTCCGCTTACG
GATCCACAAGCCGAGATCAGTCCAGCTTTCTGGCACAATGTCACCGTCGCGATGGAACGCGATCCCACGGTTTTC
CAAGATTATTGGGCGAGACGTGTTCGCGGATTCGAAGTTGAGAGCTGCAATGGTGACTGCATGAAAAATGAGATC
TGCCTTCTTCGTGCCGCCAATGCACAGTATAACTGTGATAAACCAAAGTCTTTGGACTTCTCTAAGCTTGATGGG
CAGGAGGGTGAGATCTTGCCGGAAAAGGAGCCTCGCACCAGCTGCCATCATGCTGGAATGGCGACTCTGATCTCA
AAAATGGCGCATCAGGCTAGACTTGAGGGGAGAAAGGAGCCTGAGGGTTGA
Transcript >Pro_DTO070G2_2|g2811.t1
ATGAGACTCAACTTCTTGCTGCTGGCGTTCGGCCTTTCGGCGTCTCTCCGGGGCGTACAAGCCGAGACTCAAGTC
GACCAGTCCGTCGCTTCTATCTGGGACGACTTCAAGAATACAGTTGACTGCGGTGCTTGCCAAATTCTCCTCGGC
AGCATCAAAGTTGCCGCAGGGCTTGGTGAGAATTTCATGATCGACGTATTCACAGGGTTGTGCAAAATCAGCAGG
GTCGAGGACCCAGATGTCTGCGCCGGGATCATCAAGAAAGAAGGCCCTGCGCTGCATGATGTTTTCAAACATTTA
CAACTGAACTCTGACGCCTCAAAGACACTATGCGCTAATCTGGTCGGGCTCTGCAAGCAACCCGATGTTCATTCC
TATAATTTGACGTTCCCTTCACCCAAGCCAAAGACTGTGAGGCCACCACCTAGCGGCAAGACACCGCTCAAGGTC
GTCCATTTCAGCGATACACACGTGGACCTCCTCTACGAGCCTGAATCTAGCTACAAGTGTTCCAAGCCTATCTGT
TGCAGATCTTGGTCGGATGAATATTCACCAGAGAATACAGCCTACCCATGTGGACCATTTGGAAATACGAAGTGT
GACGCACCACAAATACTTCAGGAGAGCTTGCATGCTGCTATCGCAGACATCAATCCGGAGTTCTCCATTTACACC
GGTGATGTGGTGGCCCACGATATCTGGTTGGTTGACGAGGCCGAAGCTCTGAAAGCGCTCAATGCTACGTACAGT
GCAATGGAAAAGGACATTGGCACTGTGTATGCTGCAATAGGGAATCATGACACTGCACCACTCAACCTCTTTCCC
ACGGATGCTTCGAATAAAGCTGATCCCAAATGGGCGTACTCGGCTCTTGCAGAAGATTGGTATGGCCTCACAGGT
GTTTCTTCTGTCAAATCTGCGGATCAATTCGCGTCGTACTCAGCCGTCCATCCCAACAGCAATCTGCGCATCATT
TCTTATAACAGCATCTTCTACTACGTATTCAACTTCTATATGTACCAGGAACCAATGGAGAAAGACCCACGAGGA
CAATTTGAATGGCTCATCAAGGAACTGCAGGCTGCCGAGGACGCGGGCCAACGTGCATGGCTAATCTCTCATATA
CCATCCGGTATACCAGATCACTTCCGCGACCATTCGGATTACTTCGACCAAATTGTGCAGCGTTACGAAGCCACC
ATCGCGGGATTATTCTATGGTCATACACACCGGGATGGGTTCCAGATCGCATACTCCGACTACAACGACCGAGAC
TGGAACACAGCTACTGCAATGGGTTATATTATTCCAGCCGTAACGCCAACGGAAGGCTCGCCCTCTTTCCGCGTC
TACGAAATTGATCCAGTCACTTTCGGCGTCTTGGATTACACTCAATACATCGCCAACATCAGCGACCCGTCCTTT
CAGACAAAGCCAGAATGGCTGCCCTATTACTCCGCGAAGGCAGACTATGGATCCAAGATCTCTCCTCCGCTTACG
GATCCACAAGCCGAGATCAGTCCAGCTTTCTGGCACAATGTCACCGTCGCGATGGAACGCGATCCCACGGTTTTC
CAAGATTATTGGGCGAGACGTGTTCGCGGATTCGAAGTTGAGAGCTGCAATGGTGACTGCATGAAAAATGAGATC
TGCCTTCTTCGTGCCGCCAATGCACAGTATAACTGTGATAAACCAAAGTCTTTGGACTTCTCTAAGCTTGATGGG
CAGGAGGGTGAGATCTTGCCGGAAAAGGAGCCTCGCACCAGCTGCCATCATGCTGGAATGGCGACTCTGATCTCA
AAAATGGCGCATCAGGCTAGACTTGAGGGGAGAAAGGAGCCTGAGGGTTGA
Gene >Pro_DTO070G2_2|g2811.t1
ATGAGACTCAACTTCTTGCTGCTGGCGTTCGGCCTTTCGGCGTCTCTCCGGGGCGTACAAGCCGAGACTCAAGTC
GACCAGTCCGTCGCTTCTATCTGGGACGACTTCAAGAATACAGTTGACTGCGGTGCTTGCCAAGTATGCTTATGT
TTAGCACTTCCATTCTATTGACTCCTTTGCTGACTCTATGCAATTATACAGATTCTCCTCGGCAGCATCAAAGTT
GCCGCAGGGCTTGGTGAGAATTTCATGATCGACGTATTCACAGGGTTGTGCAAAATCAGCAGGGTATGTTGGCCA
TGCTCGTGAGCTTACTGACTCAATCCCATTAATCGCAAGTGCACAGGTCGAGGACCCAGATGTCTGCGCCGGGAT
CATCAAGAAAGAAGGCCCTGCGCTGCATGATGTTTTCAAACATTTACAACTGAACTCTGACGCCTCAAAGACACT
ATGCGCTAATCTGGTCGGGCTCTGCAAGCAACCCGATGTTCATTCCTATAATTTGACGTTCCCTTCACCCAAGCC
AAAGACTGTGAGGCCACCACCTAGCGGCAAGACACCGCTCAAGGTCGTCCATTTCAGCGATACACACGTGGACCT
CCTCTACGAGCCTGAATCTAGCTACAAGTGTTCCAAGCCTATCTGTTGCAGATCTTGGTCGGATGAATATTCACC
AGAGAATACAGCCTACCCATGTGGACCATTTGGAAATACGAAGTGTGACGCACCACAAATACTTCAGGAGAGCTT
GCATGCTGCTATCGCAGACATCAATCCGGAGTTCTCCATTTACACCGGTGATGTGGTGGCCCACGATATCTGGTT
GGTTGACGAGGCCGAAGCTCTGAAAGCGCTCAATGCTACGTACAGTGCAATGGAAAAGGACATTGGCACTGTGTA
TGCTGCAATAGGGAATCATGACACTGCACCACTCAACCTCTTTCCCACGGATGCTTCGAATAAAGCTGATCCCAA
ATGGGCGTACTCGGCTCTTGCAGAAGATTGGTATGGCCTCACAGGTGTTTCTTCTGTCAAATCTGCGGATCAATT
CGCGTCGTACTCAGCCGTCCATCCCAACAGCAATCTGCGCATCATTTCTTATAACAGCATCTTCTACTACGTATT
CAACTTCTATATGTACCAGGAACCAATGGAGAAAGACCCACGAGGACAATTTGAATGGCTCATCAAGGAACTGCA
GGCTGCCGAGGACGCGGGCCAACGTGCATGGCTAATCTCTCATATACCATCCGGTATACCAGATCACTTCCGCGA
CCATTCGGATTACTTCGACCAAATTGTGCAGCGTTACGAAGCCACCATCGCGGGATTATTCTATGGTCATACACA
CCGGGATGGGTTCCAGATCGCATACTCCGACTACAACGACCGAGACTGGAACACAGCTACTGCAATGGGTTATAT
TATTCCAGCCGTAACGCCAACGGAAGGCTCGCCCTCTTTCCGCGTCTACGAAATTGATCCAGTCACTTTCGGCGT
CTTGGATTACACTCAATACATCGCCAACATCAGCGACCCGTCCTTTCAGACAAAGCCAGAATGGCTGCCCTATTA
CTCCGCGAAGGCAGACTATGGATCCAAGATCTCTCCTCCGCTTACGGATCCACAAGCCGAGATCAGTCCAGCTTT
CTGGCACAATGTCACCGTCGCGATGGAACGCGATCCCACGGTTTTCCAAGATTATTGGGCGAGACGTGTTCGCGG
ATTCGAAGTTGAGAGCTGCAATGGTGACTGCATGAAAAATGAGATCTGCCTTCTTCGTGCCGCCAATGCACAGTA
TAACTGTGATAAACCAAAGTCTTTGGACTTCTCTAAGCTTGATGGGCAGGAGGGTGAGATCTTGCCGGAAAAGGA
GCCTCGCACCAGCTGCCATCATGCTGGAATGGCGACTCTGATCTCAAAAATGGCGCATCAGGCTAGACTTGAGGG
GAGAAAGGAGCCTGAGGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail