Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g2791.t1
Gene name
Locationscaffold_02:2781615..2783406
Strand+
Gene length (bp)1791
Transcript length (bp)1791
Coding sequence length (bp)1791
Protein length (aa) 597

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 1.1E-16 447 578
PF01794 Ferric_reduct Ferric reductase like transmembrane component 3.1E-18 161 278
PF08022 FAD_binding_8 FAD-binding domain 1.4E-07 324 372

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 124 146 22
3 161 183 22
4 195 217 22
5 232 254 22
6 267 289 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g2791.t1
MHSFLLAMSLAGLTSATDIEYIEKRSGYSVYYEAINDSLARYTILALGCAAAAYYIWQLVFCFSRHLRRLASFND
DRQRYFVSTHNTFAWIKEHIIYAALFRNRHNLELQLSSAINMGTLPSRFHAFLITGVIAMNVTLCCVTTPYGTET
DTLAGVIRNRTGVMATVNLIPLILMAGRSNPLIAMLHVPFDTWNLLHRWLGRIVVLESLAHVFAWAIPKAQAKGW
KVVGMALGGSSFLLTGLVAACAFTALLLHSPSPIRHAFYETFLHLHIAITAVSMGFLWVHLNGLPAQAYLLAALI
LWALERATRFLIIVYRNCGRESTTATIEALHGDAMRITLRLARPWTFRPGQHIYLYIPAVGLWTSHPFSVGWSET
ADSHSDEKSLPLTSKDILNAPQKETISLLVRRRTGMTDKLFQRASNSPTSQITLRAFAEGPYGNIHTMDSYGTVM
LFAGGVGITHHVPFVRHLVAGFANGTVAARRVTLVWIIQSPEHLEWIRPWMTSILAMDRRREVLRIMLFITRPRN
TKEIQSPSATVQMFPGRPNIDTLVGMEVENQIGAMGVLVCGNGGLSDDVRRVCRKRQAQSSVDYVEESFSW*
Coding >Pro_DTO070G2_2|g2791.t1
ATGCACTCCTTTCTGCTGGCGATGTCCCTCGCTGGGCTGACCAGTGCGACGGATATTGAATACATCGAAAAACGA
TCGGGTTACTCCGTCTACTACGAAGCCATCAACGATAGTCTGGCACGCTATACAATCCTTGCCCTTGGCTGTGCT
GCCGCCGCTTATTACATCTGGCAGCTCGTCTTCTGCTTCTCTCGCCACCTTCGACGCCTGGCAAGCTTTAACGAT
GACCGGCAACGGTACTTCGTCTCAACACACAATACCTTTGCCTGGATCAAGGAGCATATAATCTATGCTGCATTG
TTCCGAAACCGACACAACCTTGAACTCCAGCTCTCGTCAGCTATTAACATGGGTACTTTGCCTAGCCGCTTCCAT
GCGTTCCTTATCACCGGCGTTATCGCCATGAACGTCACGCTTTGCTGTGTGACAACTCCTTATGGAACCGAAACA
GACACGCTTGCTGGTGTCATTCGTAACCGTACCGGCGTGATGGCAACGGTGAACTTGATCCCATTGATCTTGATG
GCAGGCCGTAGCAACCCTCTAATTGCTATGCTCCATGTGCCTTTTGATACATGGAATCTGCTCCACCGATGGCTC
GGCCGCATCGTGGTGCTGGAGAGTCTTGCACATGTGTTTGCATGGGCTATTCCCAAAGCCCAAGCGAAAGGCTGG
AAGGTTGTCGGAATGGCTCTGGGTGGTAGCAGCTTTTTGCTGACTGGCTTGGTGGCTGCTTGCGCGTTCACTGCG
CTCTTGCTGCATTCGCCCTCGCCTATTCGCCATGCATTCTATGAGACATTCCTCCATTTGCACATTGCCATTACG
GCAGTTTCCATGGGTTTCCTCTGGGTCCATCTCAACGGGCTGCCAGCGCAAGCCTATCTACTTGCTGCCCTCATC
CTCTGGGCACTCGAGCGAGCCACCCGCTTCTTAATCATTGTGTACCGCAACTGCGGTCGTGAATCCACCACCGCA
ACCATCGAGGCTTTGCACGGCGACGCAATGCGCATTACCCTGCGCCTGGCCCGCCCCTGGACCTTCCGTCCGGGT
CAGCACATCTACCTCTACATCCCAGCAGTGGGCTTGTGGACCTCACACCCGTTCTCCGTTGGCTGGAGTGAAACG
GCAGACAGTCATTCCGACGAGAAGTCTCTCCCACTCACAAGCAAAGACATCCTCAATGCGCCCCAAAAAGAAACC
ATCTCTCTCCTCGTCCGCCGCCGGACGGGAATGACCGACAAGCTCTTCCAGCGCGCTTCGAACTCCCCGACCTCA
CAGATTACCCTCCGCGCCTTCGCCGAGGGTCCATATGGCAACATTCACACCATGGACTCATACGGTACGGTGATG
CTCTTCGCCGGCGGAGTCGGCATCACCCACCACGTCCCCTTCGTCCGTCATCTGGTCGCCGGGTTCGCGAACGGC
ACCGTCGCCGCCCGCCGCGTCACCCTCGTCTGGATTATCCAGTCCCCTGAACACTTGGAGTGGATCCGGCCCTGG
ATGACCAGTATCTTGGCAATGGATCGCCGCCGTGAAGTCCTGCGCATTATGCTCTTTATTACACGGCCGCGCAAC
ACCAAGGAGATCCAGAGCCCCTCTGCAACCGTGCAGATGTTCCCTGGCCGTCCGAATATTGACACACTGGTCGGT
ATGGAGGTCGAGAATCAAATTGGTGCCATGGGCGTTCTTGTCTGCGGCAATGGCGGTCTGAGTGATGACGTTCGC
CGTGTTTGTCGAAAGAGGCAGGCTCAGTCTAGTGTTGATTACGTGGAAGAGAGTTTCTCTTGGTAG
Transcript >Pro_DTO070G2_2|g2791.t1
ATGCACTCCTTTCTGCTGGCGATGTCCCTCGCTGGGCTGACCAGTGCGACGGATATTGAATACATCGAAAAACGA
TCGGGTTACTCCGTCTACTACGAAGCCATCAACGATAGTCTGGCACGCTATACAATCCTTGCCCTTGGCTGTGCT
GCCGCCGCTTATTACATCTGGCAGCTCGTCTTCTGCTTCTCTCGCCACCTTCGACGCCTGGCAAGCTTTAACGAT
GACCGGCAACGGTACTTCGTCTCAACACACAATACCTTTGCCTGGATCAAGGAGCATATAATCTATGCTGCATTG
TTCCGAAACCGACACAACCTTGAACTCCAGCTCTCGTCAGCTATTAACATGGGTACTTTGCCTAGCCGCTTCCAT
GCGTTCCTTATCACCGGCGTTATCGCCATGAACGTCACGCTTTGCTGTGTGACAACTCCTTATGGAACCGAAACA
GACACGCTTGCTGGTGTCATTCGTAACCGTACCGGCGTGATGGCAACGGTGAACTTGATCCCATTGATCTTGATG
GCAGGCCGTAGCAACCCTCTAATTGCTATGCTCCATGTGCCTTTTGATACATGGAATCTGCTCCACCGATGGCTC
GGCCGCATCGTGGTGCTGGAGAGTCTTGCACATGTGTTTGCATGGGCTATTCCCAAAGCCCAAGCGAAAGGCTGG
AAGGTTGTCGGAATGGCTCTGGGTGGTAGCAGCTTTTTGCTGACTGGCTTGGTGGCTGCTTGCGCGTTCACTGCG
CTCTTGCTGCATTCGCCCTCGCCTATTCGCCATGCATTCTATGAGACATTCCTCCATTTGCACATTGCCATTACG
GCAGTTTCCATGGGTTTCCTCTGGGTCCATCTCAACGGGCTGCCAGCGCAAGCCTATCTACTTGCTGCCCTCATC
CTCTGGGCACTCGAGCGAGCCACCCGCTTCTTAATCATTGTGTACCGCAACTGCGGTCGTGAATCCACCACCGCA
ACCATCGAGGCTTTGCACGGCGACGCAATGCGCATTACCCTGCGCCTGGCCCGCCCCTGGACCTTCCGTCCGGGT
CAGCACATCTACCTCTACATCCCAGCAGTGGGCTTGTGGACCTCACACCCGTTCTCCGTTGGCTGGAGTGAAACG
GCAGACAGTCATTCCGACGAGAAGTCTCTCCCACTCACAAGCAAAGACATCCTCAATGCGCCCCAAAAAGAAACC
ATCTCTCTCCTCGTCCGCCGCCGGACGGGAATGACCGACAAGCTCTTCCAGCGCGCTTCGAACTCCCCGACCTCA
CAGATTACCCTCCGCGCCTTCGCCGAGGGTCCATATGGCAACATTCACACCATGGACTCATACGGTACGGTGATG
CTCTTCGCCGGCGGAGTCGGCATCACCCACCACGTCCCCTTCGTCCGTCATCTGGTCGCCGGGTTCGCGAACGGC
ACCGTCGCCGCCCGCCGCGTCACCCTCGTCTGGATTATCCAGTCCCCTGAACACTTGGAGTGGATCCGGCCCTGG
ATGACCAGTATCTTGGCAATGGATCGCCGCCGTGAAGTCCTGCGCATTATGCTCTTTATTACACGGCCGCGCAAC
ACCAAGGAGATCCAGAGCCCCTCTGCAACCGTGCAGATGTTCCCTGGCCGTCCGAATATTGACACACTGGTCGGT
ATGGAGGTCGAGAATCAAATTGGTGCCATGGGCGTTCTTGTCTGCGGCAATGGCGGTCTGAGTGATGACGTTCGC
CGTGTTTGTCGAAAGAGGCAGGCTCAGTCTAGTGTTGATTACGTGGAAGAGAGTTTCTCTTGGTAG
Gene >Pro_DTO070G2_2|g2791.t1
ATGCACTCCTTTCTGCTGGCGATGTCCCTCGCTGGGCTGACCAGTGCGACGGATATTGAATACATCGAAAAACGA
TCGGGTTACTCCGTCTACTACGAAGCCATCAACGATAGTCTGGCACGCTATACAATCCTTGCCCTTGGCTGTGCT
GCCGCCGCTTATTACATCTGGCAGCTCGTCTTCTGCTTCTCTCGCCACCTTCGACGCCTGGCAAGCTTTAACGAT
GACCGGCAACGGTACTTCGTCTCAACACACAATACCTTTGCCTGGATCAAGGAGCATATAATCTATGCTGCATTG
TTCCGAAACCGACACAACCTTGAACTCCAGCTCTCGTCAGCTATTAACATGGGTACTTTGCCTAGCCGCTTCCAT
GCGTTCCTTATCACCGGCGTTATCGCCATGAACGTCACGCTTTGCTGTGTGACAACTCCTTATGGAACCGAAACA
GACACGCTTGCTGGTGTCATTCGTAACCGTACCGGCGTGATGGCAACGGTGAACTTGATCCCATTGATCTTGATG
GCAGGCCGTAGCAACCCTCTAATTGCTATGCTCCATGTGCCTTTTGATACATGGAATCTGCTCCACCGATGGCTC
GGCCGCATCGTGGTGCTGGAGAGTCTTGCACATGTGTTTGCATGGGCTATTCCCAAAGCCCAAGCGAAAGGCTGG
AAGGTTGTCGGAATGGCTCTGGGTGGTAGCAGCTTTTTGCTGACTGGCTTGGTGGCTGCTTGCGCGTTCACTGCG
CTCTTGCTGCATTCGCCCTCGCCTATTCGCCATGCATTCTATGAGACATTCCTCCATTTGCACATTGCCATTACG
GCAGTTTCCATGGGTTTCCTCTGGGTCCATCTCAACGGGCTGCCAGCGCAAGCCTATCTACTTGCTGCCCTCATC
CTCTGGGCACTCGAGCGAGCCACCCGCTTCTTAATCATTGTGTACCGCAACTGCGGTCGTGAATCCACCACCGCA
ACCATCGAGGCTTTGCACGGCGACGCAATGCGCATTACCCTGCGCCTGGCCCGCCCCTGGACCTTCCGTCCGGGT
CAGCACATCTACCTCTACATCCCAGCAGTGGGCTTGTGGACCTCACACCCGTTCTCCGTTGGCTGGAGTGAAACG
GCAGACAGTCATTCCGACGAGAAGTCTCTCCCACTCACAAGCAAAGACATCCTCAATGCGCCCCAAAAAGAAACC
ATCTCTCTCCTCGTCCGCCGCCGGACGGGAATGACCGACAAGCTCTTCCAGCGCGCTTCGAACTCCCCGACCTCA
CAGATTACCCTCCGCGCCTTCGCCGAGGGTCCATATGGCAACATTCACACCATGGACTCATACGGTACGGTGATG
CTCTTCGCCGGCGGAGTCGGCATCACCCACCACGTCCCCTTCGTCCGTCATCTGGTCGCCGGGTTCGCGAACGGC
ACCGTCGCCGCCCGCCGCGTCACCCTCGTCTGGATTATCCAGTCCCCTGAACACTTGGAGTGGATCCGGCCCTGG
ATGACCAGTATCTTGGCAATGGATCGCCGCCGTGAAGTCCTGCGCATTATGCTCTTTATTACACGGCCGCGCAAC
ACCAAGGAGATCCAGAGCCCCTCTGCAACCGTGCAGATGTTCCCTGGCCGTCCGAATATTGACACACTGGTCGGT
ATGGAGGTCGAGAATCAAATTGGTGCCATGGGCGTTCTTGTCTGCGGCAATGGCGGTCTGAGTGATGACGTTCGC
CGTGTTTGTCGAAAGAGGCAGGCTCAGTCTAGTGTTGATTACGTGGAAGAGAGTTTCTCTTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail