Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g2760.t1
Gene name
Locationscaffold_02:2691481..2695312
Strand+
Gene length (bp)3831
Transcript length (bp)3831
Coding sequence length (bp)3831
Protein length (aa) 1277

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.1E-74 14 413
PF07993 NAD_binding_4 Male sterility protein 5.8E-61 649 891
PF00106 adh_short short chain dehydrogenase 2.6E-51 1036 1226
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 5.0E-38 1042 1255
PF08659 KR KR domain 7.9E-15 1039 1213
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.2E-08 647 851
PF00550 PP-binding Phosphopantetheine attachment site 3.5E-12 537 596

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g2760.t1
MAILDITKDLPTLFKRQVQATPDAIALEDETTTYTYTQLDEEVEALASRLRTYGVSRDTLVGVLLPRSAHYVIAC
LAALRAGGAFLVLELAYPADLLADVIEDASPAVIITHKSETDKIKAPVPVIALDGPIAEINGHAKEPSPLPADDD
LDRLAFVSYSSGTTGKPKGIANPHRAPVLSYDLRFAVQDVQPGDRVACNVFFIWEMLRPLLRGATVVIVPDETSY
DPAALVDLLSAKKVTETLMTPTLLATVLSRYPRFGTRVPDLRIIWLNGEVVTTDLARKAIKIIPNARLLNCYSAC
ETHEIACGDIREMVDGDSIYCPVGPSIVPAHTYVLNEDGQEVETGTSGELFIGGPLLAREYINLPETTAKAFLPD
TFDSTPGARMYRTGDLARKLPSGFLEITGRVGAMIKLRGYSVVPAKVESDICQYLAVSQCVVTAYGDGLERQLVA
YVVADKEASSDRPSVVINESGHSPSSRRVLENRLAQYMIPALWVALDQLPTNEVSGKVDMKNLPSPRSSSPNGSE
KSTGKDPIGLHDIAAIWEAVLKVSKSLIKAEDNFFDLGGHSLSLADLSSKLSRRFGFRVPIPRLAENTTLSGHLE
TVRAVRDGHTEEVQANLPAVLLSDSTLDEDIKPTNTAFTSISSAETVLLTGVTGFLGAFLLNDLIENTSAKIICL
VRFSDPEQDDQAGGVARIRRNLLDMGLWRDSILERLEILPGNLSRPRLGLSPEEFDNIAARVQVIVHAAATVNLV
YPYAALRGANVGGTREILRLAAKGGATVQYISTNGVLPPSGEKGWPETTILDIEDVPKKLLDGYGQTKWVAEQLV
LKAGERGLPVKIHRCGTISGHSVTGSANAWDLLTALIVESIQLGYAPEVDGWRAEMTPVNFVSKSIVHLATLTQA
DQTVFHLGDPTPVDTRSVFEDLKELGYETKPLPWDQWVALWFEKRGSAKGGDGSFTVDILRSGMPTVEFLRDIVV
LDNALTRPFRAVIERPKVDSLLLETYTRHWFARGWLPRPPSRQNALNRPNGVSVKGPLSGQVAVVTGASSGIGAA
VAAALAKQGCAVALGARRLDALESTKRKVEVHGVKCILRSTDVTSKSQVEALVQAASEELGPVDILVACAGVMYF
TMMANTQTDEWERTVDVNCKGLLHALSSTVPSMLSRGRGHIVAISSDAGRKVFPGLGVYSASKFFVEATLQALRL
ETAGAGLRVTSIQPGNTSTDLLGMSTDAEAVKKFGEPSGAKILDPSDVANSIVYALTQPEHVSVNEILVEPRDEP
I*
Coding >Pro_DTO070G2_2|g2760.t1
ATGGCCATCCTCGATATCACTAAGGATTTGCCCACACTATTTAAGCGACAGGTACAGGCAACCCCAGATGCCATC
GCTCTGGAAGACGAGACCACGACATATACATATACCCAGCTGGATGAAGAGGTTGAGGCTCTTGCCAGTCGCTTA
CGGACCTATGGAGTGAGCCGGGACACCCTCGTGGGTGTGCTCCTACCTCGCAGCGCACATTACGTGATTGCCTGT
CTGGCAGCGCTCCGTGCGGGTGGTGCGTTCCTTGTTCTCGAATTGGCTTACCCCGCGGACCTCTTGGCGGATGTT
ATCGAGGACGCTAGCCCCGCCGTGATTATCACCCACAAATCTGAGACCGACAAAATCAAGGCGCCCGTCCCCGTA
ATTGCCTTGGATGGACCCATTGCCGAGATCAATGGACACGCCAAGGAACCTTCTCCGTTGCCCGCAGATGACGAT
TTGGACCGTTTGGCGTTTGTGTCCTATTCGTCAGGCACAACAGGCAAGCCGAAAGGAATCGCCAATCCACACCGC
GCCCCGGTACTATCATACGATTTGAGATTTGCAGTGCAGGACGTACAACCGGGCGATCGAGTGGCCTGCAATGTC
TTCTTCATCTGGGAGATGCTGCGGCCGCTACTGCGCGGAGCTACCGTGGTTATCGTGCCCGATGAAACGAGCTAT
GACCCCGCAGCTCTGGTTGACCTGCTCTCGGCTAAGAAGGTCACTGAAACCCTCATGACACCCACACTCCTGGCT
ACCGTTCTTTCACGCTATCCCCGGTTCGGTACTCGTGTGCCTGATTTACGCATCATCTGGCTGAACGGTGAGGTG
GTGACAACCGATCTTGCCCGCAAGGCCATCAAAATTATTCCTAATGCCCGCTTGCTTAACTGCTACAGTGCGTGT
GAAACGCATGAGATTGCCTGCGGAGATATCCGTGAGATGGTTGATGGCGACTCCATTTACTGCCCAGTCGGCCCA
TCGATTGTTCCTGCACACACCTACGTTCTAAACGAGGATGGACAGGAGGTGGAGACGGGCACATCGGGAGAACTC
TTCATTGGAGGTCCTTTGTTGGCCCGCGAGTACATTAACCTTCCCGAGACCACTGCAAAGGCTTTCCTTCCAGAC
ACCTTTGATTCCACACCCGGTGCTCGTATGTACAGAACGGGCGATCTAGCCCGCAAGCTGCCTTCCGGATTCCTC
GAGATCACCGGCCGCGTCGGCGCAATGATCAAGCTGCGCGGATATTCGGTTGTGCCGGCAAAGGTCGAAAGTGAC
ATCTGCCAATACTTGGCTGTTAGTCAGTGCGTTGTCACTGCGTACGGCGATGGACTGGAACGACAACTGGTCGCA
TATGTTGTTGCCGATAAGGAGGCTTCCTCCGATCGCCCTTCGGTCGTGATCAACGAGTCCGGCCACTCCCCCAGC
TCGCGTCGTGTCCTCGAGAACCGTCTTGCCCAATACATGATCCCAGCTCTCTGGGTTGCACTAGACCAGTTGCCT
ACTAACGAGGTCTCTGGCAAGGTTGATATGAAAAATCTCCCTTCGCCTCGTAGCTCTAGTCCCAATGGCAGCGAG
AAAAGCACAGGAAAAGACCCGATCGGTCTCCATGACATTGCGGCAATCTGGGAGGCTGTTCTGAAAGTCTCAAAG
AGCCTGATTAAGGCCGAAGATAATTTCTTTGATCTGGGTGGACATTCCTTGTCTCTGGCTGATCTGTCATCCAAG
CTTTCCAGACGTTTCGGCTTCCGTGTTCCTATTCCTCGTCTTGCGGAGAACACTACTCTTTCCGGCCACTTGGAG
ACTGTGCGTGCTGTCAGAGATGGCCACACTGAAGAAGTGCAAGCAAATCTGCCCGCTGTCTTGCTTTCCGATTCC
ACACTGGACGAGGACATTAAGCCCACGAATACTGCGTTCACTTCAATCAGCTCGGCTGAGACGGTGCTTCTGACT
GGTGTGACTGGTTTCCTGGGCGCTTTCTTGCTCAATGATCTGATTGAGAACACCTCTGCTAAAATCATCTGTCTT
GTGCGTTTCAGCGACCCCGAGCAGGATGATCAAGCCGGAGGTGTGGCCCGAATCCGCAGGAACCTCCTAGATATG
GGACTCTGGCGCGATTCTATCCTGGAGCGTCTCGAAATCTTACCAGGAAACCTTTCCCGGCCTCGACTGGGCCTG
AGTCCGGAGGAATTTGACAACATCGCGGCTCGTGTCCAAGTAATTGTTCATGCTGCAGCCACTGTCAACCTTGTT
TACCCCTACGCTGCACTTCGGGGAGCGAACGTTGGTGGAACCAGAGAGATTCTGCGTCTCGCCGCTAAGGGTGGC
GCGACCGTGCAGTATATCTCTACCAATGGTGTCTTGCCCCCATCTGGCGAGAAAGGCTGGCCCGAGACTACTATA
CTAGATATAGAAGATGTCCCCAAAAAGCTACTCGATGGCTATGGCCAGACAAAGTGGGTTGCAGAGCAGCTCGTT
CTCAAGGCTGGTGAGCGTGGATTGCCAGTCAAAATTCACCGGTGCGGTACCATCAGTGGTCACAGTGTCACAGGC
TCCGCTAATGCGTGGGATTTGCTCACTGCATTGATTGTGGAATCCATCCAGCTTGGATACGCCCCAGAGGTGGAC
GGATGGCGTGCCGAGATGACCCCTGTGAACTTTGTCAGCAAATCCATTGTGCACCTTGCCACTCTGACCCAGGCA
GACCAAACAGTGTTCCATCTCGGAGACCCTACGCCGGTCGATACTCGGTCGGTCTTTGAGGACCTTAAAGAGCTT
GGTTATGAGACGAAACCTCTCCCATGGGATCAATGGGTGGCCTTATGGTTCGAGAAGAGAGGCTCGGCCAAGGGT
GGTGATGGTTCGTTTACCGTCGATATTCTTCGCAGTGGCATGCCGACTGTCGAGTTCCTCCGAGATATCGTGGTC
CTTGATAACGCTTTGACCAGGCCTTTCCGGGCCGTTATCGAGCGTCCCAAGGTGGACAGCCTGTTGCTGGAGACC
TACACTCGGCACTGGTTTGCTCGAGGATGGCTACCCCGGCCCCCATCTCGTCAGAATGCCCTCAACCGACCCAAC
GGGGTTTCAGTGAAGGGGCCACTCAGCGGTCAAGTCGCCGTGGTGACTGGTGCTTCTTCAGGCATCGGTGCGGCG
GTAGCAGCAGCCCTAGCCAAGCAGGGTTGTGCTGTAGCACTTGGCGCTCGACGCCTGGATGCTCTTGAGAGCACC
AAGCGCAAGGTCGAAGTCCACGGCGTGAAGTGTATCCTTCGATCAACCGACGTCACAAGCAAGTCTCAGGTGGAA
GCTCTCGTCCAAGCAGCAAGTGAGGAGCTCGGACCAGTGGATATCTTGGTTGCATGCGCTGGTGTCATGTACTTC
ACCATGATGGCAAACACGCAGACGGACGAGTGGGAGCGCACAGTCGACGTCAACTGCAAGGGCCTTTTGCACGCT
CTTTCGTCAACAGTGCCTAGCATGCTCTCGCGCGGCCGCGGCCATATTGTCGCCATCTCCTCCGATGCCGGACGA
AAGGTCTTCCCTGGTCTAGGTGTGTACTCGGCTAGCAAGTTCTTCGTCGAGGCCACCCTCCAAGCCCTCCGCCTC
GAGACTGCAGGCGCTGGCTTGCGCGTGACGAGTATCCAGCCCGGCAACACCTCCACTGACCTACTGGGCATGTCG
ACGGACGCTGAAGCCGTCAAGAAATTCGGAGAGCCATCCGGAGCCAAGATCCTCGATCCTTCGGATGTTGCCAAC
TCCATTGTTTACGCCCTGACGCAACCTGAGCATGTCTCCGTCAACGAGATCCTTGTTGAGCCTCGTGACGAGCCT
ATTTAA
Transcript >Pro_DTO070G2_2|g2760.t1
ATGGCCATCCTCGATATCACTAAGGATTTGCCCACACTATTTAAGCGACAGGTACAGGCAACCCCAGATGCCATC
GCTCTGGAAGACGAGACCACGACATATACATATACCCAGCTGGATGAAGAGGTTGAGGCTCTTGCCAGTCGCTTA
CGGACCTATGGAGTGAGCCGGGACACCCTCGTGGGTGTGCTCCTACCTCGCAGCGCACATTACGTGATTGCCTGT
CTGGCAGCGCTCCGTGCGGGTGGTGCGTTCCTTGTTCTCGAATTGGCTTACCCCGCGGACCTCTTGGCGGATGTT
ATCGAGGACGCTAGCCCCGCCGTGATTATCACCCACAAATCTGAGACCGACAAAATCAAGGCGCCCGTCCCCGTA
ATTGCCTTGGATGGACCCATTGCCGAGATCAATGGACACGCCAAGGAACCTTCTCCGTTGCCCGCAGATGACGAT
TTGGACCGTTTGGCGTTTGTGTCCTATTCGTCAGGCACAACAGGCAAGCCGAAAGGAATCGCCAATCCACACCGC
GCCCCGGTACTATCATACGATTTGAGATTTGCAGTGCAGGACGTACAACCGGGCGATCGAGTGGCCTGCAATGTC
TTCTTCATCTGGGAGATGCTGCGGCCGCTACTGCGCGGAGCTACCGTGGTTATCGTGCCCGATGAAACGAGCTAT
GACCCCGCAGCTCTGGTTGACCTGCTCTCGGCTAAGAAGGTCACTGAAACCCTCATGACACCCACACTCCTGGCT
ACCGTTCTTTCACGCTATCCCCGGTTCGGTACTCGTGTGCCTGATTTACGCATCATCTGGCTGAACGGTGAGGTG
GTGACAACCGATCTTGCCCGCAAGGCCATCAAAATTATTCCTAATGCCCGCTTGCTTAACTGCTACAGTGCGTGT
GAAACGCATGAGATTGCCTGCGGAGATATCCGTGAGATGGTTGATGGCGACTCCATTTACTGCCCAGTCGGCCCA
TCGATTGTTCCTGCACACACCTACGTTCTAAACGAGGATGGACAGGAGGTGGAGACGGGCACATCGGGAGAACTC
TTCATTGGAGGTCCTTTGTTGGCCCGCGAGTACATTAACCTTCCCGAGACCACTGCAAAGGCTTTCCTTCCAGAC
ACCTTTGATTCCACACCCGGTGCTCGTATGTACAGAACGGGCGATCTAGCCCGCAAGCTGCCTTCCGGATTCCTC
GAGATCACCGGCCGCGTCGGCGCAATGATCAAGCTGCGCGGATATTCGGTTGTGCCGGCAAAGGTCGAAAGTGAC
ATCTGCCAATACTTGGCTGTTAGTCAGTGCGTTGTCACTGCGTACGGCGATGGACTGGAACGACAACTGGTCGCA
TATGTTGTTGCCGATAAGGAGGCTTCCTCCGATCGCCCTTCGGTCGTGATCAACGAGTCCGGCCACTCCCCCAGC
TCGCGTCGTGTCCTCGAGAACCGTCTTGCCCAATACATGATCCCAGCTCTCTGGGTTGCACTAGACCAGTTGCCT
ACTAACGAGGTCTCTGGCAAGGTTGATATGAAAAATCTCCCTTCGCCTCGTAGCTCTAGTCCCAATGGCAGCGAG
AAAAGCACAGGAAAAGACCCGATCGGTCTCCATGACATTGCGGCAATCTGGGAGGCTGTTCTGAAAGTCTCAAAG
AGCCTGATTAAGGCCGAAGATAATTTCTTTGATCTGGGTGGACATTCCTTGTCTCTGGCTGATCTGTCATCCAAG
CTTTCCAGACGTTTCGGCTTCCGTGTTCCTATTCCTCGTCTTGCGGAGAACACTACTCTTTCCGGCCACTTGGAG
ACTGTGCGTGCTGTCAGAGATGGCCACACTGAAGAAGTGCAAGCAAATCTGCCCGCTGTCTTGCTTTCCGATTCC
ACACTGGACGAGGACATTAAGCCCACGAATACTGCGTTCACTTCAATCAGCTCGGCTGAGACGGTGCTTCTGACT
GGTGTGACTGGTTTCCTGGGCGCTTTCTTGCTCAATGATCTGATTGAGAACACCTCTGCTAAAATCATCTGTCTT
GTGCGTTTCAGCGACCCCGAGCAGGATGATCAAGCCGGAGGTGTGGCCCGAATCCGCAGGAACCTCCTAGATATG
GGACTCTGGCGCGATTCTATCCTGGAGCGTCTCGAAATCTTACCAGGAAACCTTTCCCGGCCTCGACTGGGCCTG
AGTCCGGAGGAATTTGACAACATCGCGGCTCGTGTCCAAGTAATTGTTCATGCTGCAGCCACTGTCAACCTTGTT
TACCCCTACGCTGCACTTCGGGGAGCGAACGTTGGTGGAACCAGAGAGATTCTGCGTCTCGCCGCTAAGGGTGGC
GCGACCGTGCAGTATATCTCTACCAATGGTGTCTTGCCCCCATCTGGCGAGAAAGGCTGGCCCGAGACTACTATA
CTAGATATAGAAGATGTCCCCAAAAAGCTACTCGATGGCTATGGCCAGACAAAGTGGGTTGCAGAGCAGCTCGTT
CTCAAGGCTGGTGAGCGTGGATTGCCAGTCAAAATTCACCGGTGCGGTACCATCAGTGGTCACAGTGTCACAGGC
TCCGCTAATGCGTGGGATTTGCTCACTGCATTGATTGTGGAATCCATCCAGCTTGGATACGCCCCAGAGGTGGAC
GGATGGCGTGCCGAGATGACCCCTGTGAACTTTGTCAGCAAATCCATTGTGCACCTTGCCACTCTGACCCAGGCA
GACCAAACAGTGTTCCATCTCGGAGACCCTACGCCGGTCGATACTCGGTCGGTCTTTGAGGACCTTAAAGAGCTT
GGTTATGAGACGAAACCTCTCCCATGGGATCAATGGGTGGCCTTATGGTTCGAGAAGAGAGGCTCGGCCAAGGGT
GGTGATGGTTCGTTTACCGTCGATATTCTTCGCAGTGGCATGCCGACTGTCGAGTTCCTCCGAGATATCGTGGTC
CTTGATAACGCTTTGACCAGGCCTTTCCGGGCCGTTATCGAGCGTCCCAAGGTGGACAGCCTGTTGCTGGAGACC
TACACTCGGCACTGGTTTGCTCGAGGATGGCTACCCCGGCCCCCATCTCGTCAGAATGCCCTCAACCGACCCAAC
GGGGTTTCAGTGAAGGGGCCACTCAGCGGTCAAGTCGCCGTGGTGACTGGTGCTTCTTCAGGCATCGGTGCGGCG
GTAGCAGCAGCCCTAGCCAAGCAGGGTTGTGCTGTAGCACTTGGCGCTCGACGCCTGGATGCTCTTGAGAGCACC
AAGCGCAAGGTCGAAGTCCACGGCGTGAAGTGTATCCTTCGATCAACCGACGTCACAAGCAAGTCTCAGGTGGAA
GCTCTCGTCCAAGCAGCAAGTGAGGAGCTCGGACCAGTGGATATCTTGGTTGCATGCGCTGGTGTCATGTACTTC
ACCATGATGGCAAACACGCAGACGGACGAGTGGGAGCGCACAGTCGACGTCAACTGCAAGGGCCTTTTGCACGCT
CTTTCGTCAACAGTGCCTAGCATGCTCTCGCGCGGCCGCGGCCATATTGTCGCCATCTCCTCCGATGCCGGACGA
AAGGTCTTCCCTGGTCTAGGTGTGTACTCGGCTAGCAAGTTCTTCGTCGAGGCCACCCTCCAAGCCCTCCGCCTC
GAGACTGCAGGCGCTGGCTTGCGCGTGACGAGTATCCAGCCCGGCAACACCTCCACTGACCTACTGGGCATGTCG
ACGGACGCTGAAGCCGTCAAGAAATTCGGAGAGCCATCCGGAGCCAAGATCCTCGATCCTTCGGATGTTGCCAAC
TCCATTGTTTACGCCCTGACGCAACCTGAGCATGTCTCCGTCAACGAGATCCTTGTTGAGCCTCGTGACGAGCCT
ATTTAA
Gene >Pro_DTO070G2_2|g2760.t1
ATGGCCATCCTCGATATCACTAAGGATTTGCCCACACTATTTAAGCGACAGGTACAGGCAACCCCAGATGCCATC
GCTCTGGAAGACGAGACCACGACATATACATATACCCAGCTGGATGAAGAGGTTGAGGCTCTTGCCAGTCGCTTA
CGGACCTATGGAGTGAGCCGGGACACCCTCGTGGGTGTGCTCCTACCTCGCAGCGCACATTACGTGATTGCCTGT
CTGGCAGCGCTCCGTGCGGGTGGTGCGTTCCTTGTTCTCGAATTGGCTTACCCCGCGGACCTCTTGGCGGATGTT
ATCGAGGACGCTAGCCCCGCCGTGATTATCACCCACAAATCTGAGACCGACAAAATCAAGGCGCCCGTCCCCGTA
ATTGCCTTGGATGGACCCATTGCCGAGATCAATGGACACGCCAAGGAACCTTCTCCGTTGCCCGCAGATGACGAT
TTGGACCGTTTGGCGTTTGTGTCCTATTCGTCAGGCACAACAGGCAAGCCGAAAGGAATCGCCAATCCACACCGC
GCCCCGGTACTATCATACGATTTGAGATTTGCAGTGCAGGACGTACAACCGGGCGATCGAGTGGCCTGCAATGTC
TTCTTCATCTGGGAGATGCTGCGGCCGCTACTGCGCGGAGCTACCGTGGTTATCGTGCCCGATGAAACGAGCTAT
GACCCCGCAGCTCTGGTTGACCTGCTCTCGGCTAAGAAGGTCACTGAAACCCTCATGACACCCACACTCCTGGCT
ACCGTTCTTTCACGCTATCCCCGGTTCGGTACTCGTGTGCCTGATTTACGCATCATCTGGCTGAACGGTGAGGTG
GTGACAACCGATCTTGCCCGCAAGGCCATCAAAATTATTCCTAATGCCCGCTTGCTTAACTGCTACAGTGCGTGT
GAAACGCATGAGATTGCCTGCGGAGATATCCGTGAGATGGTTGATGGCGACTCCATTTACTGCCCAGTCGGCCCA
TCGATTGTTCCTGCACACACCTACGTTCTAAACGAGGATGGACAGGAGGTGGAGACGGGCACATCGGGAGAACTC
TTCATTGGAGGTCCTTTGTTGGCCCGCGAGTACATTAACCTTCCCGAGACCACTGCAAAGGCTTTCCTTCCAGAC
ACCTTTGATTCCACACCCGGTGCTCGTATGTACAGAACGGGCGATCTAGCCCGCAAGCTGCCTTCCGGATTCCTC
GAGATCACCGGCCGCGTCGGCGCAATGATCAAGCTGCGCGGATATTCGGTTGTGCCGGCAAAGGTCGAAAGTGAC
ATCTGCCAATACTTGGCTGTTAGTCAGTGCGTTGTCACTGCGTACGGCGATGGACTGGAACGACAACTGGTCGCA
TATGTTGTTGCCGATAAGGAGGCTTCCTCCGATCGCCCTTCGGTCGTGATCAACGAGTCCGGCCACTCCCCCAGC
TCGCGTCGTGTCCTCGAGAACCGTCTTGCCCAATACATGATCCCAGCTCTCTGGGTTGCACTAGACCAGTTGCCT
ACTAACGAGGTCTCTGGCAAGGTTGATATGAAAAATCTCCCTTCGCCTCGTAGCTCTAGTCCCAATGGCAGCGAG
AAAAGCACAGGAAAAGACCCGATCGGTCTCCATGACATTGCGGCAATCTGGGAGGCTGTTCTGAAAGTCTCAAAG
AGCCTGATTAAGGCCGAAGATAATTTCTTTGATCTGGGTGGACATTCCTTGTCTCTGGCTGATCTGTCATCCAAG
CTTTCCAGACGTTTCGGCTTCCGTGTTCCTATTCCTCGTCTTGCGGAGAACACTACTCTTTCCGGCCACTTGGAG
ACTGTGCGTGCTGTCAGAGATGGCCACACTGAAGAAGTGCAAGCAAATCTGCCCGCTGTCTTGCTTTCCGATTCC
ACACTGGACGAGGACATTAAGCCCACGAATACTGCGTTCACTTCAATCAGCTCGGCTGAGACGGTGCTTCTGACT
GGTGTGACTGGTTTCCTGGGCGCTTTCTTGCTCAATGATCTGATTGAGAACACCTCTGCTAAAATCATCTGTCTT
GTGCGTTTCAGCGACCCCGAGCAGGATGATCAAGCCGGAGGTGTGGCCCGAATCCGCAGGAACCTCCTAGATATG
GGACTCTGGCGCGATTCTATCCTGGAGCGTCTCGAAATCTTACCAGGAAACCTTTCCCGGCCTCGACTGGGCCTG
AGTCCGGAGGAATTTGACAACATCGCGGCTCGTGTCCAAGTAATTGTTCATGCTGCAGCCACTGTCAACCTTGTT
TACCCCTACGCTGCACTTCGGGGAGCGAACGTTGGTGGAACCAGAGAGATTCTGCGTCTCGCCGCTAAGGGTGGC
GCGACCGTGCAGTATATCTCTACCAATGGTGTCTTGCCCCCATCTGGCGAGAAAGGCTGGCCCGAGACTACTATA
CTAGATATAGAAGATGTCCCCAAAAAGCTACTCGATGGCTATGGCCAGACAAAGTGGGTTGCAGAGCAGCTCGTT
CTCAAGGCTGGTGAGCGTGGATTGCCAGTCAAAATTCACCGGTGCGGTACCATCAGTGGTCACAGTGTCACAGGC
TCCGCTAATGCGTGGGATTTGCTCACTGCATTGATTGTGGAATCCATCCAGCTTGGATACGCCCCAGAGGTGGAC
GGATGGCGTGCCGAGATGACCCCTGTGAACTTTGTCAGCAAATCCATTGTGCACCTTGCCACTCTGACCCAGGCA
GACCAAACAGTGTTCCATCTCGGAGACCCTACGCCGGTCGATACTCGGTCGGTCTTTGAGGACCTTAAAGAGCTT
GGTTATGAGACGAAACCTCTCCCATGGGATCAATGGGTGGCCTTATGGTTCGAGAAGAGAGGCTCGGCCAAGGGT
GGTGATGGTTCGTTTACCGTCGATATTCTTCGCAGTGGCATGCCGACTGTCGAGTTCCTCCGAGATATCGTGGTC
CTTGATAACGCTTTGACCAGGCCTTTCCGGGCCGTTATCGAGCGTCCCAAGGTGGACAGCCTGTTGCTGGAGACC
TACACTCGGCACTGGTTTGCTCGAGGATGGCTACCCCGGCCCCCATCTCGTCAGAATGCCCTCAACCGACCCAAC
GGGGTTTCAGTGAAGGGGCCACTCAGCGGTCAAGTCGCCGTGGTGACTGGTGCTTCTTCAGGCATCGGTGCGGCG
GTAGCAGCAGCCCTAGCCAAGCAGGGTTGTGCTGTAGCACTTGGCGCTCGACGCCTGGATGCTCTTGAGAGCACC
AAGCGCAAGGTCGAAGTCCACGGCGTGAAGTGTATCCTTCGATCAACCGACGTCACAAGCAAGTCTCAGGTGGAA
GCTCTCGTCCAAGCAGCAAGTGAGGAGCTCGGACCAGTGGATATCTTGGTTGCATGCGCTGGTGTCATGTACTTC
ACCATGATGGCAAACACGCAGACGGACGAGTGGGAGCGCACAGTCGACGTCAACTGCAAGGGCCTTTTGCACGCT
CTTTCGTCAACAGTGCCTAGCATGCTCTCGCGCGGCCGCGGCCATATTGTCGCCATCTCCTCCGATGCCGGACGA
AAGGTCTTCCCTGGTCTAGGTGTGTACTCGGCTAGCAAGTTCTTCGTCGAGGCCACCCTCCAAGCCCTCCGCCTC
GAGACTGCAGGCGCTGGCTTGCGCGTGACGAGTATCCAGCCCGGCAACACCTCCACTGACCTACTGGGCATGTCG
ACGGACGCTGAAGCCGTCAAGAAATTCGGAGAGCCATCCGGAGCCAAGATCCTCGATCCTTCGGATGTTGCCAAC
TCCATTGTTTACGCCCTGACGCAACCTGAGCATGTCTCCGTCAACGAGATCCTTGTTGAGCCTCGTGACGAGCCT
ATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail