Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g2714.t1
Gene name
Locationscaffold_02:2568123..2572753
Strand-
Gene length (bp)4630
Transcript length (bp)4440
Coding sequence length (bp)4440
Protein length (aa) 1480

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18404 Glyco_transf_24 Glucosyltransferase 24 1.2E-146 1186 1452
PF18402 Thioredoxin_14 Thioredoxin-like domain 1.8E-62 414 657
PF18400 Thioredoxin_12 Thioredoxin-like domain 1.1E-49 43 225
PF18403 Thioredoxin_15 Thioredoxin-like domain 1.6E-43 672 865
PF18401 Thioredoxin_13 Thioredoxin-like domain 6.1E-42 280 408
PF06427 UDP-g_GGTase UDP-glucose:Glycoprotein Glucosyltransferase 4.1E-42 1037 1146

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0003980 UDP-glucose:glycoprotein glucosyltransferase activity Yes
GO:0019538 protein metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0044238 primary metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0043413 macromolecule glycosylation No
GO:0070085 glycosylation No
GO:0036211 protein modification process No
GO:0043412 macromolecule modification No
GO:0016740 transferase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0046527 glucosyltransferase activity No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0003824 catalytic activity No
GO:0016757 glycosyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT24 7.2E-132 1186 1433

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup5807
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g6398.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g7309.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g5756.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g3882.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g4920.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g2272.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g5579.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g3123.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g2698.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g3618.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g2288.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g1745.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g5117.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g1354.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g1872.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g9050.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g1290.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g2310.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g2714.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g3980.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g7173.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g2357.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g908.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g11.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g5433.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g2479.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g1199.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g1648.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g5663.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g2065.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g3326.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g4470.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g951.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g2646.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g2714.t1
MRVPTGSHIPWQWYAVVGALLPGWVANASPAVNVALQASFDSAPYLVELLESAAEENSTAYFPLLDRIADGTFED
LTTEKELYDRFLTVVKDDGHIRTPEGLSSFKLSLSVRSSAPRIEAHFQFYNTSVQQSLMVAQDAVCPVWVHSEGK
QYCSSTMERAQQDVVGELDPRELPFDRVLGDASLPSAVLYADITSPMFRDFHETLSDMAKQGQVSYRVRYRPPQH
WISRPLFVSGYGVELALKRTDYIVIDDRDAEQLEEKGAQSLPTDPDETKEDAPGDLRPLSSSDVTRLGLNSAGYV
MDSADPLGTLIKMSQNFPKYSSIVAAHNFTGEMAQEIRHNRLKMLPGGYNAMWINGVQMDKQQIDAFSLIEHLRR
ERKLIEKFRGLGLSADDVVKLLSHRLLTEAQASGEEQRYDYRDNLEGNQVIIWMNNLEKDSRYESWRGDIEGYIA
GSYPGQLPPVSRDLHNVVVSMDSSNPEHMMLVAGNLHAFINRGIPVRFGLVPTISSPESIAQLKVAHYLSDAYGI
ESLVQYFQEYAAKGKMGFPDKSCFQSATRERDLVDEHEALSLDQVLKSEKYDAVVSQTGAYQRRLSLTGDAPQFL
VNGIPVSREGNWMQGMSVQISKDLKLIQQGIVQGIFEEDTWLPEFFLADAFAKRNTFLMPEDPKSVQIVDIANIL
ASDEDALSKTRVLSDKGALESTHMIVVGDFESEAGVKLLTDALNLRKENSDVEILMLHNAASDAEDDAPKNLATL
YLSLAKEETIDQVLAKIASGNLETEVQDISTIQTLHQILAKELGFNPGTEGLVVNGRAVGPIEKEHPLSVGEMSQ
LIAYERVKRLDSVAAAVEELGFADKISNPLDFAKLTSLVALSTISDVPEGIFENTPDFRMDVSGKWRTEHSVITI
SNSDDPTIHVGVSLDPASEVAQRWSPILKVLSELSGVQLKIFLNPKEELTELPVKRFYRYVLESEPSFTDKGALA
RPQASFTGVPVEALLTLSMDVPSSWLVAPSESVYDLDNIKLSSVKSGTDVDAVYALEHILIEGHSRDLTTKTPPR
GVQLILGTENNPYFADTIIMANLGYFQFKAQPGLWQINLKPGRSEKIFKIDSVGGLGYNPQSGDENNEVALLSFH
GRTLFPRLSRKPGHEEDDVLETGVQLGSKMDYFAKGLNFASDVLSSVGVGSKSGGEQHADINIFSVASGHLYERM
LNIMMVSVMRHTKHTVKFWFIEQFLSPSFRAFLPSLAREYGFSYEMVTYKWPHWLRAQKEKQREIWGYKILFLDV
LFPLSLDKVIFVDADQIVRTDMYELVTHDLQEAPYGFTPMGDSRTEMEGFRFWKQGYWSTFLRGKPYHISALYVV
DLNRFRALAAGDRLRGQYQMLSSDPNSLSNLDQDLPNHMQHHIPIHSLPQEWLWCETWCSDEDLGVAKTIDLCNN
PLTKEPKLERARRQVPEWTVYDDEIAALASRVAGEQAAAGVEFVQTGEDRKDEL*
Coding >Pro_DTO070G2_2|g2714.t1
ATGAGGGTTCCTACGGGATCTCACATTCCCTGGCAGTGGTATGCCGTCGTCGGAGCTCTGCTACCAGGCTGGGTT
GCCAATGCTAGTCCAGCCGTGAACGTGGCGCTCCAAGCCTCCTTTGACTCGGCCCCATACCTCGTCGAGCTCCTG
GAGTCTGCTGCAGAAGAAAACTCCACCGCCTATTTTCCTTTGTTGGATCGCATCGCCGATGGGACGTTTGAGGAC
CTCACAACTGAGAAGGAGCTCTACGACCGCTTCTTGACAGTTGTGAAGGATGACGGCCATATTCGGACTCCGGAG
GGTCTTTCCTCGTTCAAATTATCGCTTTCGGTCCGATCATCGGCGCCTCGTATTGAGGCGCACTTCCAGTTCTAT
AACACCTCAGTTCAGCAGTCCTTGATGGTGGCTCAAGATGCGGTGTGTCCCGTGTGGGTTCACTCGGAAGGAAAG
CAGTATTGCTCTTCTACCATGGAGCGCGCACAGCAGGACGTTGTCGGAGAATTGGATCCTAGAGAGCTACCGTTT
GATCGTGTCCTAGGCGATGCATCGCTCCCTTCGGCCGTTCTGTACGCAGATATCACCTCTCCGATGTTCAGAGAT
TTTCATGAAACCCTGAGCGACATGGCAAAACAGGGACAAGTCTCGTACCGTGTACGCTATAGACCTCCCCAACAC
TGGATTTCTCGTCCCTTGTTTGTGTCTGGATACGGCGTGGAGCTTGCTTTGAAGCGAACGGACTACATTGTTATT
GATGACCGTGATGCAGAGCAGCTCGAAGAAAAGGGCGCCCAAAGTCTTCCAACTGACCCGGATGAGACCAAGGAA
GATGCTCCAGGTGACCTCCGGCCTCTGTCTTCCTCCGATGTGACCCGTCTAGGCTTGAACTCTGCGGGCTACGTT
ATGGACAGCGCTGATCCTTTGGGAACATTGATCAAGATGTCCCAAAATTTCCCCAAGTATTCATCGATAGTAGCT
GCCCACAATTTCACTGGGGAAATGGCACAAGAGATCCGCCACAACCGGTTAAAAATGCTCCCTGGTGGTTACAAT
GCCATGTGGATCAACGGTGTGCAGATGGACAAACAACAGATTGACGCATTCTCACTTATTGAACATCTTCGCCGA
GAGAGGAAATTGATTGAGAAATTCCGCGGCCTCGGTCTCTCTGCGGATGATGTCGTGAAGTTACTGTCACATCGA
CTCCTCACTGAAGCTCAAGCTAGTGGCGAGGAGCAACGGTATGACTACCGGGATAATTTAGAAGGGAACCAGGTT
ATCATTTGGATGAACAATCTGGAAAAGGACTCGAGATATGAGTCCTGGCGTGGTGATATCGAGGGGTACATCGCC
GGCTCTTACCCGGGACAATTGCCTCCGGTGAGCCGGGATCTGCACAATGTCGTTGTTTCTATGGACTCGTCTAAT
CCAGAACACATGATGCTTGTTGCTGGAAACTTGCACGCCTTCATCAACCGAGGAATTCCTGTGAGATTCGGCTTG
GTACCTACCATCTCGTCGCCAGAGTCCATTGCGCAGCTGAAGGTAGCGCATTACCTTTCTGATGCATATGGCATA
GAGTCTCTTGTGCAATATTTCCAAGAGTATGCCGCGAAAGGCAAAATGGGCTTCCCAGACAAATCATGCTTCCAG
TCTGCGACTAGAGAACGCGACCTGGTTGACGAACACGAAGCTCTGTCTCTTGATCAAGTCTTGAAGAGTGAAAAG
TATGACGCTGTGGTGTCCCAAACTGGTGCTTACCAGCGTCGGTTGAGTCTGACGGGCGACGCACCTCAATTTCTA
GTGAACGGTATCCCTGTCTCCCGAGAAGGCAACTGGATGCAGGGAATGAGCGTACAGATCAGCAAGGACTTGAAA
TTGATCCAGCAAGGCATTGTTCAGGGAATTTTCGAGGAGGACACATGGCTTCCGGAGTTTTTCCTAGCTGACGCA
TTCGCGAAACGCAATACTTTCCTCATGCCCGAGGATCCCAAGAGTGTACAGATTGTGGACATCGCTAATATTCTT
GCCTCGGATGAAGATGCATTGAGTAAGACTCGTGTTCTCTCAGACAAGGGAGCCCTAGAGAGCACTCATATGATA
GTTGTGGGCGATTTCGAGTCAGAGGCGGGTGTGAAACTACTTACCGATGCTCTTAATCTTCGAAAGGAGAACAGT
GACGTGGAGATTCTGATGCTGCACAATGCGGCATCGGACGCCGAGGATGATGCCCCCAAGAATCTCGCTACTCTC
TATCTCTCGCTTGCGAAGGAGGAAACTATCGACCAAGTACTGGCTAAGATTGCATCCGGTAATCTTGAGACTGAA
GTCCAAGATATCTCTACCATTCAAACTTTGCACCAAATCCTGGCCAAAGAACTTGGATTCAACCCTGGCACTGAG
GGACTTGTTGTCAATGGGAGAGCAGTCGGCCCTATTGAGAAGGAACATCCGTTGAGTGTGGGAGAGATGAGCCAA
CTGATTGCCTACGAACGGGTGAAACGCCTCGATTCTGTTGCGGCAGCTGTTGAGGAACTCGGATTCGCGGATAAG
ATTTCAAACCCGCTCGATTTCGCTAAATTGACATCGCTTGTGGCTCTTTCCACCATCTCTGATGTCCCTGAGGGC
ATTTTCGAAAATACTCCTGATTTCAGAATGGACGTCTCCGGTAAATGGAGGACGGAGCACTCTGTTATCACCATT
TCCAACTCCGATGATCCCACGATTCACGTTGGTGTTAGCCTTGACCCAGCATCCGAGGTTGCCCAGCGATGGTCG
CCGATTCTGAAGGTACTGTCCGAACTCTCCGGCGTTCAACTGAAGATTTTCTTGAACCCGAAGGAAGAGCTCACG
GAGCTGCCAGTCAAGCGATTCTACCGCTATGTCTTGGAATCAGAGCCATCTTTCACGGATAAGGGGGCTCTGGCT
CGGCCGCAGGCGTCATTCACTGGCGTGCCAGTCGAAGCACTGCTGACTTTGAGCATGGATGTGCCGTCATCTTGG
CTCGTAGCACCCAGTGAATCAGTCTACGACCTGGATAACATTAAGTTGAGCTCGGTCAAGTCTGGTACTGATGTT
GATGCCGTCTACGCTCTCGAGCACATTCTGATCGAGGGCCACTCTCGTGATCTTACAACGAAGACTCCACCTAGA
GGTGTCCAGCTTATCTTGGGCACTGAGAACAACCCCTATTTCGCCGATACTATCATCATGGCCAACCTGGGATAC
TTCCAGTTCAAGGCACAGCCAGGCTTGTGGCAGATCAACTTGAAGCCCGGACGTAGCGAGAAGATCTTCAAGATC
GATAGCGTTGGTGGTCTAGGATACAATCCGCAGAGCGGTGACGAGAACAATGAGGTTGCTCTGCTATCCTTCCAT
GGTCGGACGCTATTCCCTCGACTGTCGCGAAAGCCAGGCCACGAGGAAGACGATGTTCTCGAGACAGGAGTCCAG
CTAGGCTCAAAGATGGACTATTTTGCCAAAGGACTCAACTTTGCATCTGACGTCCTCTCCAGTGTTGGTGTCGGG
TCCAAGAGCGGAGGCGAACAGCACGCCGATATCAACATCTTCTCAGTAGCTAGTGGACACCTCTATGAGCGCATG
TTAAACATCATGATGGTCTCAGTGATGCGACACACCAAACACACCGTCAAATTCTGGTTCATCGAGCAATTCCTC
TCCCCATCCTTCCGCGCCTTCCTCCCTTCTCTCGCCCGCGAATACGGCTTCTCATACGAGATGGTAACATACAAG
TGGCCGCACTGGCTGCGCGCCCAGAAAGAAAAGCAACGCGAGATCTGGGGGTACAAGATTCTCTTCCTGGATGTG
CTCTTTCCCCTCTCCCTGGACAAAGTAATCTTCGTCGACGCGGATCAGATTGTGCGCACCGACATGTACGAACTT
GTCACCCACGACCTCCAAGAAGCGCCCTACGGCTTCACGCCGATGGGCGACTCTCGAACCGAAATGGAAGGCTTC
CGCTTCTGGAAACAAGGATACTGGTCCACCTTCCTCCGAGGCAAGCCTTACCACATCTCGGCGCTGTACGTCGTC
GACTTGAACCGCTTCCGCGCGCTTGCTGCTGGCGACCGTCTGCGCGGCCAATACCAGATGCTCTCATCGGATCCA
AACAGTCTCAGCAATCTCGACCAGGACCTGCCCAACCACATGCAGCATCACATTCCCATCCATAGTCTGCCGCAG
GAGTGGCTTTGGTGTGAGACTTGGTGTTCGGATGAAGATTTAGGTGTGGCGAAGACTATTGACCTTTGTAACAAT
CCTCTTACTAAGGAGCCTAAGCTAGAGAGGGCTAGGAGGCAGGTTCCTGAATGGACGGTCTATGATGATGAGATT
GCGGCTTTGGCGAGTCGCGTTGCTGGCGAGCAGGCTGCTGCTGGGGTTGAGTTTGTGCAGACTGGCGAGGACCGC
AAAGATGAATTATAG
Transcript >Pro_DTO070G2_2|g2714.t1
ATGAGGGTTCCTACGGGATCTCACATTCCCTGGCAGTGGTATGCCGTCGTCGGAGCTCTGCTACCAGGCTGGGTT
GCCAATGCTAGTCCAGCCGTGAACGTGGCGCTCCAAGCCTCCTTTGACTCGGCCCCATACCTCGTCGAGCTCCTG
GAGTCTGCTGCAGAAGAAAACTCCACCGCCTATTTTCCTTTGTTGGATCGCATCGCCGATGGGACGTTTGAGGAC
CTCACAACTGAGAAGGAGCTCTACGACCGCTTCTTGACAGTTGTGAAGGATGACGGCCATATTCGGACTCCGGAG
GGTCTTTCCTCGTTCAAATTATCGCTTTCGGTCCGATCATCGGCGCCTCGTATTGAGGCGCACTTCCAGTTCTAT
AACACCTCAGTTCAGCAGTCCTTGATGGTGGCTCAAGATGCGGTGTGTCCCGTGTGGGTTCACTCGGAAGGAAAG
CAGTATTGCTCTTCTACCATGGAGCGCGCACAGCAGGACGTTGTCGGAGAATTGGATCCTAGAGAGCTACCGTTT
GATCGTGTCCTAGGCGATGCATCGCTCCCTTCGGCCGTTCTGTACGCAGATATCACCTCTCCGATGTTCAGAGAT
TTTCATGAAACCCTGAGCGACATGGCAAAACAGGGACAAGTCTCGTACCGTGTACGCTATAGACCTCCCCAACAC
TGGATTTCTCGTCCCTTGTTTGTGTCTGGATACGGCGTGGAGCTTGCTTTGAAGCGAACGGACTACATTGTTATT
GATGACCGTGATGCAGAGCAGCTCGAAGAAAAGGGCGCCCAAAGTCTTCCAACTGACCCGGATGAGACCAAGGAA
GATGCTCCAGGTGACCTCCGGCCTCTGTCTTCCTCCGATGTGACCCGTCTAGGCTTGAACTCTGCGGGCTACGTT
ATGGACAGCGCTGATCCTTTGGGAACATTGATCAAGATGTCCCAAAATTTCCCCAAGTATTCATCGATAGTAGCT
GCCCACAATTTCACTGGGGAAATGGCACAAGAGATCCGCCACAACCGGTTAAAAATGCTCCCTGGTGGTTACAAT
GCCATGTGGATCAACGGTGTGCAGATGGACAAACAACAGATTGACGCATTCTCACTTATTGAACATCTTCGCCGA
GAGAGGAAATTGATTGAGAAATTCCGCGGCCTCGGTCTCTCTGCGGATGATGTCGTGAAGTTACTGTCACATCGA
CTCCTCACTGAAGCTCAAGCTAGTGGCGAGGAGCAACGGTATGACTACCGGGATAATTTAGAAGGGAACCAGGTT
ATCATTTGGATGAACAATCTGGAAAAGGACTCGAGATATGAGTCCTGGCGTGGTGATATCGAGGGGTACATCGCC
GGCTCTTACCCGGGACAATTGCCTCCGGTGAGCCGGGATCTGCACAATGTCGTTGTTTCTATGGACTCGTCTAAT
CCAGAACACATGATGCTTGTTGCTGGAAACTTGCACGCCTTCATCAACCGAGGAATTCCTGTGAGATTCGGCTTG
GTACCTACCATCTCGTCGCCAGAGTCCATTGCGCAGCTGAAGGTAGCGCATTACCTTTCTGATGCATATGGCATA
GAGTCTCTTGTGCAATATTTCCAAGAGTATGCCGCGAAAGGCAAAATGGGCTTCCCAGACAAATCATGCTTCCAG
TCTGCGACTAGAGAACGCGACCTGGTTGACGAACACGAAGCTCTGTCTCTTGATCAAGTCTTGAAGAGTGAAAAG
TATGACGCTGTGGTGTCCCAAACTGGTGCTTACCAGCGTCGGTTGAGTCTGACGGGCGACGCACCTCAATTTCTA
GTGAACGGTATCCCTGTCTCCCGAGAAGGCAACTGGATGCAGGGAATGAGCGTACAGATCAGCAAGGACTTGAAA
TTGATCCAGCAAGGCATTGTTCAGGGAATTTTCGAGGAGGACACATGGCTTCCGGAGTTTTTCCTAGCTGACGCA
TTCGCGAAACGCAATACTTTCCTCATGCCCGAGGATCCCAAGAGTGTACAGATTGTGGACATCGCTAATATTCTT
GCCTCGGATGAAGATGCATTGAGTAAGACTCGTGTTCTCTCAGACAAGGGAGCCCTAGAGAGCACTCATATGATA
GTTGTGGGCGATTTCGAGTCAGAGGCGGGTGTGAAACTACTTACCGATGCTCTTAATCTTCGAAAGGAGAACAGT
GACGTGGAGATTCTGATGCTGCACAATGCGGCATCGGACGCCGAGGATGATGCCCCCAAGAATCTCGCTACTCTC
TATCTCTCGCTTGCGAAGGAGGAAACTATCGACCAAGTACTGGCTAAGATTGCATCCGGTAATCTTGAGACTGAA
GTCCAAGATATCTCTACCATTCAAACTTTGCACCAAATCCTGGCCAAAGAACTTGGATTCAACCCTGGCACTGAG
GGACTTGTTGTCAATGGGAGAGCAGTCGGCCCTATTGAGAAGGAACATCCGTTGAGTGTGGGAGAGATGAGCCAA
CTGATTGCCTACGAACGGGTGAAACGCCTCGATTCTGTTGCGGCAGCTGTTGAGGAACTCGGATTCGCGGATAAG
ATTTCAAACCCGCTCGATTTCGCTAAATTGACATCGCTTGTGGCTCTTTCCACCATCTCTGATGTCCCTGAGGGC
ATTTTCGAAAATACTCCTGATTTCAGAATGGACGTCTCCGGTAAATGGAGGACGGAGCACTCTGTTATCACCATT
TCCAACTCCGATGATCCCACGATTCACGTTGGTGTTAGCCTTGACCCAGCATCCGAGGTTGCCCAGCGATGGTCG
CCGATTCTGAAGGTACTGTCCGAACTCTCCGGCGTTCAACTGAAGATTTTCTTGAACCCGAAGGAAGAGCTCACG
GAGCTGCCAGTCAAGCGATTCTACCGCTATGTCTTGGAATCAGAGCCATCTTTCACGGATAAGGGGGCTCTGGCT
CGGCCGCAGGCGTCATTCACTGGCGTGCCAGTCGAAGCACTGCTGACTTTGAGCATGGATGTGCCGTCATCTTGG
CTCGTAGCACCCAGTGAATCAGTCTACGACCTGGATAACATTAAGTTGAGCTCGGTCAAGTCTGGTACTGATGTT
GATGCCGTCTACGCTCTCGAGCACATTCTGATCGAGGGCCACTCTCGTGATCTTACAACGAAGACTCCACCTAGA
GGTGTCCAGCTTATCTTGGGCACTGAGAACAACCCCTATTTCGCCGATACTATCATCATGGCCAACCTGGGATAC
TTCCAGTTCAAGGCACAGCCAGGCTTGTGGCAGATCAACTTGAAGCCCGGACGTAGCGAGAAGATCTTCAAGATC
GATAGCGTTGGTGGTCTAGGATACAATCCGCAGAGCGGTGACGAGAACAATGAGGTTGCTCTGCTATCCTTCCAT
GGTCGGACGCTATTCCCTCGACTGTCGCGAAAGCCAGGCCACGAGGAAGACGATGTTCTCGAGACAGGAGTCCAG
CTAGGCTCAAAGATGGACTATTTTGCCAAAGGACTCAACTTTGCATCTGACGTCCTCTCCAGTGTTGGTGTCGGG
TCCAAGAGCGGAGGCGAACAGCACGCCGATATCAACATCTTCTCAGTAGCTAGTGGACACCTCTATGAGCGCATG
TTAAACATCATGATGGTCTCAGTGATGCGACACACCAAACACACCGTCAAATTCTGGTTCATCGAGCAATTCCTC
TCCCCATCCTTCCGCGCCTTCCTCCCTTCTCTCGCCCGCGAATACGGCTTCTCATACGAGATGGTAACATACAAG
TGGCCGCACTGGCTGCGCGCCCAGAAAGAAAAGCAACGCGAGATCTGGGGGTACAAGATTCTCTTCCTGGATGTG
CTCTTTCCCCTCTCCCTGGACAAAGTAATCTTCGTCGACGCGGATCAGATTGTGCGCACCGACATGTACGAACTT
GTCACCCACGACCTCCAAGAAGCGCCCTACGGCTTCACGCCGATGGGCGACTCTCGAACCGAAATGGAAGGCTTC
CGCTTCTGGAAACAAGGATACTGGTCCACCTTCCTCCGAGGCAAGCCTTACCACATCTCGGCGCTGTACGTCGTC
GACTTGAACCGCTTCCGCGCGCTTGCTGCTGGCGACCGTCTGCGCGGCCAATACCAGATGCTCTCATCGGATCCA
AACAGTCTCAGCAATCTCGACCAGGACCTGCCCAACCACATGCAGCATCACATTCCCATCCATAGTCTGCCGCAG
GAGTGGCTTTGGTGTGAGACTTGGTGTTCGGATGAAGATTTAGGTGTGGCGAAGACTATTGACCTTTGTAACAAT
CCTCTTACTAAGGAGCCTAAGCTAGAGAGGGCTAGGAGGCAGGTTCCTGAATGGACGGTCTATGATGATGAGATT
GCGGCTTTGGCGAGTCGCGTTGCTGGCGAGCAGGCTGCTGCTGGGGTTGAGTTTGTGCAGACTGGCGAGGACCGC
AAAGATGAATTATAG
Gene >Pro_DTO070G2_2|g2714.t1
ATGAGGGTTCCTACGGGATCTCACATTCCCTGGCAGTGGTATGCCGTCGTCGGAGCTCTGCTACCAGGCTGGGTT
GCCAATGCTAGTCCAGCCGTGAACGTGGCGCTCCAAGCCTCCTTTGACTCGGCCCCATACCTCGTCGAGCTCCTG
TACGTTGCACATTGAGTGATCTCTCGCCTGGGATATATATGTCAATATGATGGCTAATTAATTCAATGTAGGGAG
TCTGCTGCAGAAGAAAACTCCACCGCCTATTTTCCTTTGTTGGATCGCATCGCCGATGGGACGTTTGAGGACCTC
ACAACTGAGAAGGAGCTCTACGACCGCTTCTTGACAGTTGTGAAGGATGACGGCCATATTCGGACTCCGGAGGGT
CTTTCCTCGTTCAAATTATCGCTTTCGGTCCGATCATCGGCGCCTCGTATTGAGGCGCACTTCCAGTTCTATAAC
ACCTCAGTTCAGCAGTCCTTGATGGTGGCTCAAGATGCGGTGTGTCCCGTGTGGGTTCACTCGGAAGGAAAGCAG
TATTGCTCTTCTACCATGGAGCGCGCACAGCAGGACGTTGTCGGAGAATTGTGGGTAGAGCTTTGTTCGTGTCGC
ATGGACTCTAATAGCTGACATTGAATTTGTGCCTTTAGGGATCCTAGAGAGCTACCGTTTGATCGTGTCCTAGGC
GATGCATCGCTCCCTTCGGCCGTTCTGTACGCAGATATCACCTCTCCGATGTTCAGAGATTTTCATGAAACCCTG
AGCGACATGGCAAAACAGGGACAAGTCTCGTACCGTGTACGCTATAGACCTCCCCAACACTGGATTTCTCGTCCC
TTGTTTGTGTCTGGATACGGCGTGGAGCTTGCTTTGAAGCGAACGGACTACATTGTTATTGATGACCGTGATGCA
GAGCAGCTCGAAGAAAAGGGCGCCCAAAGTCTTCCAACTGACCCGGATGAGACCAAGGAAGATGCTCCAGGTGAC
CTCCGGCCTCTGTCTTCCTCCGATGTGACCCGTCTAGGCTTGAACTCTGCGGGCTACGTTATGGACAGCGCTGAT
CCTTTGGGAACATTGATCAAGATGTCCCAAAATTTCCCCAAGTATTCATCGATAGTAGCTGCCCACAATTTCACT
GGGGAAATGGCACAAGAGATCCGCCACAACCGGTTAAAAATGCTCCCTGGTGGTTACAATGCCATGTGGATCAAC
GGTGTGCAGATGGACAAACAACAGATTGACGCATTCTCACTTATTGAACATCTTCGCCGAGAGAGGAAATTGATT
GAGAAATTCCGCGGCCTCGGTCTCTCTGCGGATGATGTCGTGAAGTTACTGTCACATCGACTCCTCACTGAAGCT
CAAGCTAGTGGCGAGGAGCAACGGTATGACTACCGGGATAATTTAGAAGGGAACCAGGTTATCATTTGGATGAAC
AATCTGGAAAAGGACTCGAGATATGAGTCCTGGCGTGGTGATATCGAGGGGGTTCGTACTTATTTCGTATGGCTA
TTGGACGGAATTCATATTAACATAATTCTAGTACATCGCCGGCTCTTACCCGGGACAATTGCCTCCGGTGAGCCG
GGATCTGCACAATGTCGTTGTTTCTATGGACTCGTCTAATCCAGAACACATGATGCTTGTTGCTGGAAACTTGCA
CGCCTTCATCAACCGAGGAATTCCTGTGAGATTCGGCTTGGTACCTACCATCTCGTCGCCAGAGTCCATTGCGCA
GCTGAAGGTAGCGCATTACCTTTCTGATGCATATGGCATAGAGTCTCTTGTGCAATATTTCCAAGAGTATGCCGC
GAAAGGCAAAATGGGCTTCCCAGACAAATCATGCTTCCAGTCTGCGACTAGAGAACGCGACCTGGTTGACGAACA
CGAAGCTCTGTCTCTTGATCAAGTCTTGAAGAGTGAAAAGTATGACGCTGTGGTGTCCCAAACTGGTGCTTACCA
GCGTCGGTTGAGTCTGACGGGCGACGCACCTCAATTTCTAGTGAACGGTATCCCTGTCTCCCGAGAAGGCAACTG
GATGCAGGGAATGAGCGTACAGATCAGCAAGGACTTGAAATTGATCCAGCAAGGCATTGTTCAGGGAATTTTCGA
GGAGGACACATGGCTTCCGGAGTTTTTCCTAGCTGACGCATTCGCGAAACGCAATACTTTCCTCATGCCCGAGGA
TCCCAAGAGTGTACAGATTGTGGACATCGCTAATATTCTTGCCTCGGATGAAGATGCATTGAGTAAGACTCGTGT
TCTCTCAGACAAGGGAGCCCTAGAGAGCACTCATATGATAGTTGTGGGCGATTTCGAGTCAGAGGCGGGTGTGAA
ACTACTTACCGATGCTCTTAATCTTCGAAAGGAGAACAGTGACGTGGAGATTCTGATGCTGCACAATGCGGCATC
GGACGCCGAGGATGATGCCCCCAAGAATCTCGCTACTCTCTATCTCTCGCTTGCGAAGGAGGAAACTATCGACCA
AGTACTGGCTAAGATTGCATCCGGTAATCTTGAGACTGAAGTCCAAGATATCTCTACCATTCAAACTTTGCACCA
AATCCTGGCCAAAGAACTTGGATTCAACCCTGGCACTGAGGGACTTGTTGTCAATGGGAGAGCAGTCGGCCCTAT
TGAGAAGGAACATCCGTTGAGTGTGGGAGAGATGAGCCAACTGATTGCCTACGAACGGGTGAAACGCCTCGATTC
TGTTGCGGCAGCTGTTGAGGAACTCGGATTCGCGGATAAGATTTCAAACCCGCTCGATTTCGCTAAATTGACATC
GCTTGTGGCTCTTTCCACCATCTCTGATGTCCCTGAGGGCATTTTCGAAAATACTCCTGATTTCAGAATGGACGT
CTCCGGTAAATGGAGGACGGAGCACTCTGTTATCACCATTTCCAACTCCGATGATCCCACGATTCACGTTGGTGT
TAGCCTTGACCCAGCATCCGAGGTTGCCCAGCGATGGTCGCCGATTCTGAAGGTACTGTCCGAACTCTCCGGCGT
TCAACTGAAGATTTTCTTGAACCCGAAGGAAGAGCTCACGGAGCTGCCAGTCAAGCGATTCTACCGCTATGTCTT
GGAATCAGAGCCATCTTTCACGGATAAGGGGGCTCTGGCTCGGCCGCAGGCGTCATTCACTGGCGTGCCAGTCGA
AGCACTGCTGACTTTGAGCATGGATGTGCCGTCATCTTGGCTCGTAGCACCCAGTGAATCAGTCTACGACCTGGA
TAACATTAAGTTGAGCTCGGTCAAGTCTGGTACTGATGTTGATGCCGTCTACGCTCTCGAGCACATTCTGATCGA
GGGCCACTCTCGTGATCTTACAACGAAGACTCCACCTAGAGGTGTCCAGCTTATCTTGGGCACTGAGAACAACCC
CTATTTCGCCGATACTATCATCATGGCCAACCTGGGATACTTCCAGTTCAAGGCACAGCCAGGCTTGTGGCAGAT
CAACTTGAAGCCCGGACGTAGCGAGAAGATCTTCAAGATCGATAGCGTTGGTGGTCTAGGATACAATCCGCAGAG
CGGTGACGAGAACAATGAGGTTGCTCTGCTATCCTTCCATGGTCGGACGCTATTCCCTCGACTGTCGCGAAAGCC
AGGCCACGAGGAAGACGATGTTCTCGAGACAGGAGTCCAGCTAGGCTCAAAGATGGACTATTTTGCCAAAGGACT
CAACTTTGCATCTGACGTCCTCTCCAGTGTTGGTGTCGGGTCCAAGAGCGGAGGCGAACAGCACGCCGATATCAA
CATCTTCTCAGTAGCTAGTGGACACCTCTATGAGCGCATGTTAAACATCATGATGGTCTCAGTGATGCGACACAC
CAAACACACCGTCAAATTCTGGTTCATCGAGCAATTCCTCTCCCCATCCTTCCGCGCCTTCCTCCCTTCTCTCGC
CCGCGAATACGGCTTCTCATACGAGATGGTAACATACAAGTGGCCGCACTGGCTGCGCGCCCAGAAAGAAAAGCA
ACGCGAGATCTGGGGGTACAAGATTCTCTTCCTGGATGTGCTCTTTCCCCTCTCCCTGGACAAAGTAATCTTCGT
CGACGCGGATCAGATTGTGCGCACCGACATGTACGAACTTGTCACCCACGACCTCCAAGAAGCGCCCTACGGCTT
CACGCCGATGGGCGACTCTCGAACCGAAATGGAAGGCTTCCGCTTCTGGAAACAAGGATACTGGTCCACCTTCCT
CCGAGGCAAGCCTTACCACATCTCGGCGCTGTACGTCGTCGACTTGAACCGCTTCCGCGCGCTTGCTGCTGGCGA
CCGTCTGCGCGGCCAATACCAGATGCTCTCATCGGATCCAAACAGTCTCAGCAATCTCGACCAGGACCTGCCCAA
CCACATGCAGCATCACATTCCCATCCATAGTCTGCCGCAGGAGTGGCTTTGGTGTGAGACTTGGTGTTCGGATGA
AGATTTAGGTGTGGCGAAGACTATTGACCTTTGTAACAATCCTCTTACTAAGGAGCCTAAGCTAGAGAGGGCTAG
GAGGCAGGTTCCTGAATGGACGGTCTATGATGATGAGATTGCGGCTTTGGCGAGTCGCGTTGCTGGCGAGCAGGC
TGCTGCTGGGGTTGAGTTTGTGCAGACTGGCGAGGACCGCAAAGATGAATTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail