Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g2697.t1
Gene name
Locationscaffold_02:2531090..2532774
Strand+
Gene length (bp)1684
Transcript length (bp)1632
Coding sequence length (bp)1632
Protein length (aa) 544

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07156 Prenylcys_lyase Prenylcysteine lyase 4.0E-99 153 533
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.9E-12 46 112
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 6.2E-11 56 351

GO

GO Term Description Terminal node
GO:0030328 prenylcysteine catabolic process Yes
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor Yes
GO:0016491 oxidoreductase activity Yes
GO:0009056 catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0042219 cellular modified amino acid catabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0006575 cellular modified amino acid metabolic process No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:1901575 organic substance catabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0030329 prenylcysteine metabolic process No
GO:1901565 organonitrogen compound catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g2697.t1
MWPSMPRHIPLLLYSILAALLVSFGNAAEQEQLREAASATPKRVAIIGAGAGGSFAAYQLRKLADEANIPVEITV
YERESYVGGRSTTVNVFDDPAYPIELGASIFVQINYNLVNASRDLGLTVNSADHARPRETAESIGIWDGTQFVFT
LTNSYSWWNIGRLFWRYGLAPLRTQNLVKNVVGRFLRLYEEPLFPFSSLTEAAIAADLINATASPGDVFLRANEI
SSLFANEIIQASTRVNYGQNLQLIHGLESVVCMATDGAVSIEGGNWRIFDGALRASEVNIKVNTTATEISRNDDG
TVRVSSEVNTATSSEHELFDEVVIAGPLQYSGISVSPPLEHTPDEIPYVNLHVTLFASPHRISPKYFGLNDSNAR
APETILTTLPKGVDLGSNPDGVGLTEFWSISTLRTVDHSVAGSKDKQQHYVYKIFSPERPTAEFIAQILGLESEI
AGSNTTIGDLSLGDISWFHEKLWNPYPLLYPRVTFEETLLAPGVWYTGGIESFISTMETSALMGRNVATLMFQSW
QKQGDQTDSDASSWDREL*
Coding >Pro_DTO070G2_2|g2697.t1
ATGTGGCCGTCTATGCCACGGCATATCCCTCTCTTACTGTACTCCATCCTAGCTGCCCTACTCGTCTCGTTTGGC
AATGCAGCAGAACAAGAGCAACTGCGAGAAGCCGCCAGTGCAACCCCAAAGCGTGTGGCAATAATCGGCGCCGGA
GCCGGAGGCTCGTTTGCTGCATATCAACTGCGCAAGCTGGCAGATGAAGCCAACATTCCTGTGGAAATCACAGTC
TATGAGCGTGAATCATATGTTGGCGGCCGCTCAACAACAGTCAATGTATTCGACGACCCGGCGTACCCCATTGAA
CTGGGTGCTTCCATTTTTGTTCAGATCAATTACAACCTGGTCAACGCTTCCCGTGACCTCGGCCTGACGGTCAAT
AGTGCTGACCATGCACGGCCCAGGGAGACTGCTGAGAGTATCGGGATCTGGGATGGAACCCAGTTCGTTTTCACG
TTGACGAATTCGTATAGCTGGTGGAATATCGGCCGGCTCTTCTGGCGTTATGGACTGGCGCCTCTGCGTACTCAG
AATCTGGTAAAGAATGTCGTTGGCAGGTTTCTCCGCCTTTATGAAGAGCCTTTATTCCCTTTCAGCTCTCTTACT
GAGGCAGCTATTGCGGCTGACTTGATCAATGCTACTGCATCTCCTGGCGATGTGTTTCTCCGGGCAAATGAAATC
AGCTCGCTGTTTGCGAATGAGATCATCCAAGCAAGTACTCGAGTGAATTATGGACAGAACCTGCAGCTGATTCAT
GGCTTGGAATCTGTCGTCTGTATGGCTACGGATGGAGCGGTTTCTATCGAGGGTGGAAATTGGCGCATTTTCGAT
GGCGCGCTGAGGGCCTCGGAGGTGAATATCAAAGTGAATACCACCGCCACTGAGATTTCACGCAACGATGATGGG
ACTGTACGGGTCTCCTCAGAGGTCAACACCGCTACCAGCTCCGAGCATGAGCTATTCGACGAAGTTGTCATTGCC
GGTCCTTTGCAGTACTCGGGTATCTCCGTCTCCCCTCCCTTGGAACACACTCCAGATGAGATTCCATATGTCAAT
TTGCACGTTACTCTCTTTGCATCCCCTCACCGCATCTCGCCGAAGTATTTTGGTCTGAACGATTCAAATGCTCGA
GCGCCCGAGACTATTCTGACCACTCTACCCAAGGGCGTTGATCTGGGTTCGAACCCAGATGGTGTTGGCCTCACC
GAATTCTGGAGTATTAGTACACTTCGAACAGTAGATCATTCTGTTGCGGGTTCCAAAGACAAACAGCAACATTAT
GTTTACAAAATCTTCTCGCCAGAGCGGCCCACGGCTGAATTCATTGCCCAGATTCTGGGGCTGGAGAGTGAGATT
GCGGGGAGCAATACGACCATTGGAGACCTATCGTTAGGCGATATCAGCTGGTTCCATGAGAAGCTATGGAACCCA
TACCCTCTTCTGTATCCGCGAGTGACCTTTGAGGAGACTCTTCTAGCTCCAGGTGTGTGGTACACAGGTGGCATC
GAGAGCTTCATCTCGACAATGGAGACTAGTGCGTTGATGGGCCGGAACGTGGCAACTCTCATGTTCCAGTCGTGG
CAGAAGCAAGGAGATCAGACAGACAGTGATGCCTCGTCCTGGGACAGGGAGCTGTAA
Transcript >Pro_DTO070G2_2|g2697.t1
ATGTGGCCGTCTATGCCACGGCATATCCCTCTCTTACTGTACTCCATCCTAGCTGCCCTACTCGTCTCGTTTGGC
AATGCAGCAGAACAAGAGCAACTGCGAGAAGCCGCCAGTGCAACCCCAAAGCGTGTGGCAATAATCGGCGCCGGA
GCCGGAGGCTCGTTTGCTGCATATCAACTGCGCAAGCTGGCAGATGAAGCCAACATTCCTGTGGAAATCACAGTC
TATGAGCGTGAATCATATGTTGGCGGCCGCTCAACAACAGTCAATGTATTCGACGACCCGGCGTACCCCATTGAA
CTGGGTGCTTCCATTTTTGTTCAGATCAATTACAACCTGGTCAACGCTTCCCGTGACCTCGGCCTGACGGTCAAT
AGTGCTGACCATGCACGGCCCAGGGAGACTGCTGAGAGTATCGGGATCTGGGATGGAACCCAGTTCGTTTTCACG
TTGACGAATTCGTATAGCTGGTGGAATATCGGCCGGCTCTTCTGGCGTTATGGACTGGCGCCTCTGCGTACTCAG
AATCTGGTAAAGAATGTCGTTGGCAGGTTTCTCCGCCTTTATGAAGAGCCTTTATTCCCTTTCAGCTCTCTTACT
GAGGCAGCTATTGCGGCTGACTTGATCAATGCTACTGCATCTCCTGGCGATGTGTTTCTCCGGGCAAATGAAATC
AGCTCGCTGTTTGCGAATGAGATCATCCAAGCAAGTACTCGAGTGAATTATGGACAGAACCTGCAGCTGATTCAT
GGCTTGGAATCTGTCGTCTGTATGGCTACGGATGGAGCGGTTTCTATCGAGGGTGGAAATTGGCGCATTTTCGAT
GGCGCGCTGAGGGCCTCGGAGGTGAATATCAAAGTGAATACCACCGCCACTGAGATTTCACGCAACGATGATGGG
ACTGTACGGGTCTCCTCAGAGGTCAACACCGCTACCAGCTCCGAGCATGAGCTATTCGACGAAGTTGTCATTGCC
GGTCCTTTGCAGTACTCGGGTATCTCCGTCTCCCCTCCCTTGGAACACACTCCAGATGAGATTCCATATGTCAAT
TTGCACGTTACTCTCTTTGCATCCCCTCACCGCATCTCGCCGAAGTATTTTGGTCTGAACGATTCAAATGCTCGA
GCGCCCGAGACTATTCTGACCACTCTACCCAAGGGCGTTGATCTGGGTTCGAACCCAGATGGTGTTGGCCTCACC
GAATTCTGGAGTATTAGTACACTTCGAACAGTAGATCATTCTGTTGCGGGTTCCAAAGACAAACAGCAACATTAT
GTTTACAAAATCTTCTCGCCAGAGCGGCCCACGGCTGAATTCATTGCCCAGATTCTGGGGCTGGAGAGTGAGATT
GCGGGGAGCAATACGACCATTGGAGACCTATCGTTAGGCGATATCAGCTGGTTCCATGAGAAGCTATGGAACCCA
TACCCTCTTCTGTATCCGCGAGTGACCTTTGAGGAGACTCTTCTAGCTCCAGGTGTGTGGTACACAGGTGGCATC
GAGAGCTTCATCTCGACAATGGAGACTAGTGCGTTGATGGGCCGGAACGTGGCAACTCTCATGTTCCAGTCGTGG
CAGAAGCAAGGAGATCAGACAGACAGTGATGCCTCGTCCTGGGACAGGGAGCTGTAA
Gene >Pro_DTO070G2_2|g2697.t1
ATGTGGCCGTCTATGCCACGGCATATCCCTCTCTTACTGTACTCCATCCTAGCTGCCCTACTCGTCTCGTTTGGC
AATGCAGCAGAACAAGAGCAACTGCGAGAAGCCGCCAGTGCAACCCCAAAGCGTGTGGCAATAATCGGTATGCCT
CTCTCTAAAGAACACAGTTCCATACGGGGCTGATACTCCCATAGGCGCCGGAGCCGGAGGCTCGTTTGCTGCATA
TCAACTGCGCAAGCTGGCAGATGAAGCCAACATTCCTGTGGAAATCACAGTCTATGAGCGTGAATCATATGTTGG
CGGCCGCTCAACAACAGTCAATGTATTCGACGACCCGGCGTACCCCATTGAACTGGGTGCTTCCATTTTTGTTCA
GATCAATTACAACCTGGTCAACGCTTCCCGTGACCTCGGCCTGACGGTCAATAGTGCTGACCATGCACGGCCCAG
GGAGACTGCTGAGAGTATCGGGATCTGGGATGGAACCCAGTTCGTTTTCACGTTGACGAATTCGTATAGCTGGTG
GAATATCGGCCGGCTCTTCTGGCGTTATGGACTGGCGCCTCTGCGTACTCAGAATCTGGTAAAGAATGTCGTTGG
CAGGTTTCTCCGCCTTTATGAAGAGCCTTTATTCCCTTTCAGCTCTCTTACTGAGGCAGCTATTGCGGCTGACTT
GATCAATGCTACTGCATCTCCTGGCGATGTGTTTCTCCGGGCAAATGAAATCAGCTCGCTGTTTGCGAATGAGAT
CATCCAAGCAAGTACTCGAGTGAATTATGGACAGAACCTGCAGCTGATTCATGGCTTGGAATCTGTCGTCTGTAT
GGCTACGGATGGAGCGGTTTCTATCGAGGGTGGAAATTGGCGCATTTTCGATGGCGCGCTGAGGGCCTCGGAGGT
GAATATCAAAGTGAATACCACCGCCACTGAGATTTCACGCAACGATGATGGGACTGTACGGGTCTCCTCAGAGGT
CAACACCGCTACCAGCTCCGAGCATGAGCTATTCGACGAAGTTGTCATTGCCGGTCCTTTGCAGTACTCGGGTAT
CTCCGTCTCCCCTCCCTTGGAACACACTCCAGATGAGATTCCATATGTCAATTTGCACGTTACTCTCTTTGCATC
CCCTCACCGCATCTCGCCGAAGTATTTTGGTCTGAACGATTCAAATGCTCGAGCGCCCGAGACTATTCTGACCAC
TCTACCCAAGGGCGTTGATCTGGGTTCGAACCCAGATGGTGTTGGCCTCACCGAATTCTGGAGTATTAGTACACT
TCGAACAGTAGATCATTCTGTTGCGGGTTCCAAAGACAAACAGCAACATTATGTTTACAAAATCTTCTCGCCAGA
GCGGCCCACGGCTGAATTCATTGCCCAGATTCTGGGGCTGGAGAGTGAGATTGCGGGGAGCAATACGACCATTGG
AGACCTATCGTTAGGCGATATCAGCTGGTTCCATGAGAAGCTATGGAACCCATACCCTCTTCTGTATCCGCGAGT
GACCTTTGAGGAGACTCTTCTAGCTCCAGGTGTGTGGTACACAGGTGGCATCGAGAGCTTCATCTCGACAATGGA
GACTAGTGCGTTGATGGGCCGGAACGTGGCAACTCTCATGTTCCAGTCGTGGCAGAAGCAAGGAGATCAGACAGA
CAGTGATGCCTCGTCCTGGGACAGGGAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail