Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g2658.t1
Gene name
Locationscaffold_02:2420545..2421959
Strand-
Gene length (bp)1414
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00491 Arginase Arginase family 1.9E-90 61 354

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g2658.t1
MRFTTSTLSLLLQGAIALNIGPEYSHPIEDLDVDLPFSQPVTFAHLEWQRCLAASHNNPLDIAILGFPYDTSTSY
RPGARFGPRGIRAGSAREKKGRSYNTVWEVDPYEEGLEIIDCGDIPITPFDAAHAFKQMEQGYRQVLYHPTSEEN
SWEHPRIVSLGGDHSIVLPILRSLKHVYGPISVIHLDSHLDTWDPYEGYTGIASNQSAITHGTFFWHASREGCIA
KGTSVHGGLRTKLFSPKDYEIDRNVGFTIIEAHEIDDIGMSGIVKKVRSVVGDTPTYLSIDIDVLDPSIAPATGT
PESGGWTTRELKRFIKGLEGVNLVGADVVEVSPPYDTVAETTSIAAADLIVDILASMSKLKTGPKVKAPSSRDEL
*
Coding >Pro_DTO070G2_2|g2658.t1
ATGCGCTTCACTACTTCCACATTATCTCTTCTTTTGCAGGGCGCTATTGCTTTGAATATCGGCCCAGAATATAGT
CATCCGATAGAAGATCTCGACGTCGATCTTCCATTCTCTCAGCCAGTCACATTTGCCCACCTAGAATGGCAAAGA
TGTCTCGCAGCATCTCACAATAATCCTCTTGACATCGCCATTCTTGGCTTCCCCTACGACACCTCAACATCATAT
CGTCCCGGAGCAAGATTTGGTCCTCGAGGCATCCGCGCAGGATCGGCGCGTGAGAAGAAGGGCCGAAGCTATAAC
ACCGTGTGGGAGGTGGATCCATATGAAGAGGGACTTGAAATTATTGACTGTGGTGATATACCCATCACCCCATTC
GATGCCGCGCACGCTTTCAAACAAATGGAGCAGGGTTACAGACAGGTTCTTTACCACCCGACGTCCGAGGAAAAC
TCATGGGAACATCCTCGGATCGTGAGTCTGGGTGGAGACCACTCGATTGTCTTGCCTATCTTGCGATCATTGAAA
CATGTGTATGGACCGATCTCCGTTATTCACTTAGATTCGCACCTCGACACTTGGGATCCTTATGAGGGTTACACT
GGAATCGCGTCCAACCAGTCGGCAATTACACATGGAACTTTCTTCTGGCATGCGAGTCGGGAGGGCTGTATTGCC
AAGGGGACGAGTGTGCATGGAGGTCTAAGAACGAAGCTTTTTAGTCCTAAGGATTACGAGATCGACCGAAATGTT
GGATTTACGATTATCGAGGCCCATGAGATTGACGATATCGGCATGTCCGGGATCGTTAAAAAGGTCCGGAGTGTT
GTCGGGGATACTCCGACTTATCTTTCCATTGATATTGACGTCCTCGATCCGAGCATTGCCCCTGCGACCGGAACT
CCTGAATCGGGCGGATGGACCACTCGTGAATTGAAGCGATTCATTAAAGGCCTTGAAGGTGTGAATCTCGTTGGT
GCCGATGTGGTGGAAGTCAGCCCACCATATGACACCGTTGCTGAGACTACTTCTATTGCTGCTGCGGATTTGATC
GTTGATATTCTGGCTTCCATGTCGAAGTTGAAGACAGGTCCTAAGGTGAAGGCGCCAAGTTCAAGAGATGAGCTG
TGA
Transcript >Pro_DTO070G2_2|g2658.t1
ATGCGCTTCACTACTTCCACATTATCTCTTCTTTTGCAGGGCGCTATTGCTTTGAATATCGGCCCAGAATATAGT
CATCCGATAGAAGATCTCGACGTCGATCTTCCATTCTCTCAGCCAGTCACATTTGCCCACCTAGAATGGCAAAGA
TGTCTCGCAGCATCTCACAATAATCCTCTTGACATCGCCATTCTTGGCTTCCCCTACGACACCTCAACATCATAT
CGTCCCGGAGCAAGATTTGGTCCTCGAGGCATCCGCGCAGGATCGGCGCGTGAGAAGAAGGGCCGAAGCTATAAC
ACCGTGTGGGAGGTGGATCCATATGAAGAGGGACTTGAAATTATTGACTGTGGTGATATACCCATCACCCCATTC
GATGCCGCGCACGCTTTCAAACAAATGGAGCAGGGTTACAGACAGGTTCTTTACCACCCGACGTCCGAGGAAAAC
TCATGGGAACATCCTCGGATCGTGAGTCTGGGTGGAGACCACTCGATTGTCTTGCCTATCTTGCGATCATTGAAA
CATGTGTATGGACCGATCTCCGTTATTCACTTAGATTCGCACCTCGACACTTGGGATCCTTATGAGGGTTACACT
GGAATCGCGTCCAACCAGTCGGCAATTACACATGGAACTTTCTTCTGGCATGCGAGTCGGGAGGGCTGTATTGCC
AAGGGGACGAGTGTGCATGGAGGTCTAAGAACGAAGCTTTTTAGTCCTAAGGATTACGAGATCGACCGAAATGTT
GGATTTACGATTATCGAGGCCCATGAGATTGACGATATCGGCATGTCCGGGATCGTTAAAAAGGTCCGGAGTGTT
GTCGGGGATACTCCGACTTATCTTTCCATTGATATTGACGTCCTCGATCCGAGCATTGCCCCTGCGACCGGAACT
CCTGAATCGGGCGGATGGACCACTCGTGAATTGAAGCGATTCATTAAAGGCCTTGAAGGTGTGAATCTCGTTGGT
GCCGATGTGGTGGAAGTCAGCCCACCATATGACACCGTTGCTGAGACTACTTCTATTGCTGCTGCGGATTTGATC
GTTGATATTCTGGCTTCCATGTCGAAGTTGAAGACAGGTCCTAAGGTGAAGGCGCCAAGTTCAAGAGATGAGCTG
TGA
Gene >Pro_DTO070G2_2|g2658.t1
ATGCGCTTCACTACTTCCACATTATCTCTTCTTTTGCAGGGCGCTATTGCTTTGAATATCGGCCCAGAATATAGT
CATCCGATAGAAGGTCAGTCACGCAAGATGACCCAAAGATCAACTTACTAAACAGACAATAGATCTCGACGTCGA
TCTTCCATTCTCTCAGCCAGTCACATTTGCCCACCTAGAATGGCAAAGATGTCTCGCAGCATCTCACAATAATGT
ATGCAGCCAAAACATTTGTTTACCAATAATTCCACAGAGACCTAACCTTCGCAAAAGCCTCTTGACATCGCCATT
CTTGGCTTCCCCTACGACACCTCAACATCATATCGTCCCGGAGCAAGATTTGGTCCTCGAGGCATCCGCGCAGGA
TCGGCGCGTGAGAAGAAGGGCCGAAGCTATAACACCGTGTGGGAGGTGGATCCATATGAAGAGGGACTTGAAATT
GTGAGTGTAGTGCATTTTAAATCGATGAAGTTTATGAAATGCAATGTCGGGATCGCTAATCCATCATTAGATTGA
CTGTGGTGATATACCCATCACCCCATTCGATGCCGCGCACGCTTTCAAACAAATGGAGCAGGGTTACAGACAGGT
TCTTTACCACCCGACGTCCGAGGAAAACTCATGGGAACATCCTCGGATCGTGAGTCTGGGTGGAGACCACTCGAT
TGTCTTGCCTATCTTGCGATCATTGAAACATGTGTATGGACCGATCTCCGTTATTCACTTAGATTCGCACCTCGA
CACTTGGGATCCTTATGAGGGTTACACTGGAATCGCGTCCAACCAGTCGGCAATTACACATGGAACTTTCTTCTG
GCATGCGAGTCGGGAGGGCTGTATTGCCAAGGGGACGAGTGTGCATGGAGGTCTAAGAACGAAGCTTTTTGTGAG
TTGTGCGTGGCTCTTGTCGGGAATGAATACTAATCGGAATTATCAACAGAGTCCTAAGGATTACGAGATCGACCG
AAATGTTGGATTTACGATTATCGAGGCCCATGAGATTGACGATATCGGCATGTCCGGGATCGTTAAAAAGGTCCG
GAGTGTTGTCGGGGATACTCCGACTTATCTTTCCATTGATATTGACGGTGAGATTGCCCTTTCCTCTATCTAAGA
CACAGCAGATACTAATCCTCAACTAGTCCTCGATCCGAGCATTGCCCCTGCGACCGGAACTCCTGAATCGGGCGG
ATGGACCACTCGTGAATTGAAGCGATTCATTAAAGGCCTTGAAGGTGTGAATCTCGTTGGTGCCGATGTGGTGGA
AGTCAGCCCACCATATGACACCGTTGCTGAGACTACTTCTATTGCTGCTGCGGATTTGATCGTTGATATTCTGGC
TTCCATGTCGAAGTTGAAGACAGGTCCTAAGGTGAAGGCGCCAAGTTCAAGAGATGAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail