Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g248.t1
Gene name
Locationscaffold_01:654326..655702
Strand+
Gene length (bp)1376
Transcript length (bp)1218
Coding sequence length (bp)1218
Protein length (aa) 406

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 2.2E-58 81 402

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0051179 localization No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0015075 ion transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 80 102 22
3 109 131 22
4 146 168 22
5 301 323 22
6 350 372 22
7 385 404 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g248.t1
MASRFFPSRRTGIALLAGCFLFSALAAANVGPGGLSVGQIEEQLQSCPLVESLNEHKRATRPESTSLTAKIFAVL
FPSTPAVNALLATLYISGPPNFLLALCPPNIDPSSLSVMVAFAVGGLLGDTLFHLLPEIFVGEASPDHVSFVMVE
PNKNLLLGLGIMVGFFTFVAMDKTLRIATGGEGGHDHSHSHAHTEPVDAVTSGADSKKTSGELKKRKSAAKESAE
VVPEKEINPSVKLGGYLNLIADFTHNITDGLALSSSFYASPTIGATTTVAVFFHEIPHEVGDFALLIQSGFSKRK
AMGAQFVTAIGAFLGTFIGIAVQEFGGNGTMLDDSKSAGLLGTSLTWGDMLLPFTAGTFLYVGTVAVIPELLETG
KDKGVEVRKTITQFLAVALGAGIMLAISWD*
Coding >Pro_DTO070G2_2|g248.t1
ATGGCTTCTCGCTTTTTTCCATCACGCAGGACAGGCATTGCCCTTCTTGCAGGATGCTTTTTGTTCTCAGCCTTA
GCTGCAGCTAATGTTGGTCCCGGAGGGCTCTCCGTGGGTCAGATCGAGGAGCAATTGCAGAGCTGCCCACTAGTC
GAGTCTCTCAATGAGCACAAGCGTGCAACTCGTCCAGAGTCCACTAGCTTGACAGCGAAGATCTTTGCTGTCCTC
TTCCCGAGCACCCCAGCCGTGAACGCGCTTCTGGCAACTTTGTATATCTCCGGCCCACCTAACTTCCTCCTGGCA
CTATGCCCACCCAACATCGACCCCTCCTCTCTGTCAGTGATGGTTGCATTTGCCGTCGGCGGCTTACTTGGCGAC
ACCCTCTTCCACCTACTCCCCGAGATCTTTGTCGGCGAAGCCTCCCCCGACCACGTGAGCTTCGTAATGGTCGAG
CCAAACAAGAACCTCCTTCTGGGTCTGGGAATCATGGTCGGATTCTTCACCTTCGTGGCAATGGACAAAACCCTG
CGCATCGCCACTGGCGGCGAGGGCGGTCATGACCACTCGCACAGCCACGCGCACACAGAACCAGTCGATGCAGTT
ACATCCGGAGCTGACAGCAAGAAGACCAGCGGCGAGCTGAAGAAGCGCAAGTCTGCTGCCAAGGAGTCCGCTGAG
GTCGTTCCCGAGAAAGAAATCAACCCCAGCGTCAAGCTTGGCGGTTACCTGAATCTCATCGCTGACTTCACCCAT
AACATCACTGATGGCCTTGCTCTTTCCTCTTCTTTCTATGCCTCACCTACTATCGGCGCGACGACCACTGTGGCT
GTCTTCTTCCACGAAATCCCCCATGAAGTCGGTGACTTTGCTCTGCTGATTCAGTCTGGCTTCTCGAAGCGCAAG
GCCATGGGCGCGCAATTCGTGACCGCTATTGGTGCGTTCTTGGGCACTTTTATTGGAATCGCTGTCCAGGAATTC
GGTGGCAATGGCACTATGTTGGATGATAGCAAGTCTGCTGGTCTTCTGGGAACTAGCCTTACTTGGGGTGATATG
CTTCTTCCGTTCACGGCGGGCACATTCTTGTATGTTGGCACCGTGGCTGTGATTCCGGAGTTGCTGGAGACTGGC
AAGGATAAGGGCGTTGAGGTGCGGAAGACTATCACGCAGTTCTTGGCTGTTGCTCTTGGAGCCGGTATTATGCTT
GCTATTTCTTGGGATTGA
Transcript >Pro_DTO070G2_2|g248.t1
ATGGCTTCTCGCTTTTTTCCATCACGCAGGACAGGCATTGCCCTTCTTGCAGGATGCTTTTTGTTCTCAGCCTTA
GCTGCAGCTAATGTTGGTCCCGGAGGGCTCTCCGTGGGTCAGATCGAGGAGCAATTGCAGAGCTGCCCACTAGTC
GAGTCTCTCAATGAGCACAAGCGTGCAACTCGTCCAGAGTCCACTAGCTTGACAGCGAAGATCTTTGCTGTCCTC
TTCCCGAGCACCCCAGCCGTGAACGCGCTTCTGGCAACTTTGTATATCTCCGGCCCACCTAACTTCCTCCTGGCA
CTATGCCCACCCAACATCGACCCCTCCTCTCTGTCAGTGATGGTTGCATTTGCCGTCGGCGGCTTACTTGGCGAC
ACCCTCTTCCACCTACTCCCCGAGATCTTTGTCGGCGAAGCCTCCCCCGACCACGTGAGCTTCGTAATGGTCGAG
CCAAACAAGAACCTCCTTCTGGGTCTGGGAATCATGGTCGGATTCTTCACCTTCGTGGCAATGGACAAAACCCTG
CGCATCGCCACTGGCGGCGAGGGCGGTCATGACCACTCGCACAGCCACGCGCACACAGAACCAGTCGATGCAGTT
ACATCCGGAGCTGACAGCAAGAAGACCAGCGGCGAGCTGAAGAAGCGCAAGTCTGCTGCCAAGGAGTCCGCTGAG
GTCGTTCCCGAGAAAGAAATCAACCCCAGCGTCAAGCTTGGCGGTTACCTGAATCTCATCGCTGACTTCACCCAT
AACATCACTGATGGCCTTGCTCTTTCCTCTTCTTTCTATGCCTCACCTACTATCGGCGCGACGACCACTGTGGCT
GTCTTCTTCCACGAAATCCCCCATGAAGTCGGTGACTTTGCTCTGCTGATTCAGTCTGGCTTCTCGAAGCGCAAG
GCCATGGGCGCGCAATTCGTGACCGCTATTGGTGCGTTCTTGGGCACTTTTATTGGAATCGCTGTCCAGGAATTC
GGTGGCAATGGCACTATGTTGGATGATAGCAAGTCTGCTGGTCTTCTGGGAACTAGCCTTACTTGGGGTGATATG
CTTCTTCCGTTCACGGCGGGCACATTCTTGTATGTTGGCACCGTGGCTGTGATTCCGGAGTTGCTGGAGACTGGC
AAGGATAAGGGCGTTGAGGTGCGGAAGACTATCACGCAGTTCTTGGCTGTTGCTCTTGGAGCCGGTATTATGCTT
GCTATTTCTTGGGATTGA
Gene >Pro_DTO070G2_2|g248.t1
ATGGCTTCTCGCTTTTTTCCATCACGCAGGACAGGCATTGCCCTTCTTGCAGGATGCTTTTTGTTCTCAGCCTTA
GCTGCAGCTAATGTTGGTCCCGGAGGGCTCTCCGTGGGTCAGATCGAGGAGCAATTGCAGGTATGCTGTACAAGT
ACTGTGTGTCCTACATGTAAACTGACCTGCCACAGAGCTGCCCACTAGTCGAGTCTCTCAATGAGCACAAGCGTG
CAACTCGTCCAGAGTCCACTAGCTTGACAGCGAAGATCTTTGCTGTCCTCTTCCCGAGCACCCCAGCCGTGAACG
CGCTTCTGGCAACTTTGTATATCTCCGGCCCACCTAGTAAGTATTCCCTCGGTACTCGTGATATGCCTCTGCTAA
CTGCTCTAGACTTCCTCCTGGCACTATGCCCACCCAACATCGACCCCTCCTCTCTGTCAGTGATGGTTGCATTTG
CCGTCGGCGGCTTACTTGGCGACACCCTCTTCCACCTACTCCCCGAGATCTTTGTCGGCGAAGCCTCCCCCGACC
ACGTGAGCTTCGTAATGGTCGAGCCAAACAAGAACCTCCTTCTGGGTCTGGGAATCATGGTCGGATTCTTCACCT
TCGTGGCAATGGACAAAACCCTGCGCATCGCCACTGGCGGCGAGGGCGGTCATGACCACTCGCACAGCCACGCGC
ACACAGAACCAGTCGATGCAGTTACATCCGGAGCTGACAGCAAGAAGACCAGCGGCGAGCTGAAGAAGCGCAAGT
CTGCTGCCAAGGAGTCCGCTGAGGTCGTTCCCGAGAAAGAAATCAACCCCAGCGTCAAGCTTGGCGGTTACCTGA
ATCTCATCGCTGACTTCACCCATAACATCACTGATGGCCTTGCTCTTTCCTCTTCTTTCTATGCCTCACCTACTA
TCGGCGCGACGACCACTGTGGCTGTCTTCTTCCACGAAATCCCCCATGAAGTCGGTGACTTTGCTCTGCTGATTC
AGTCTGGCTTCTCGAAGCGCAAGGCCATGGGCGCGCAATTCGTGACCGCTATTGGTGCGTTCTTGGGCACTTTTA
TTGGAATCGCTGTCCAGGAATTCGGTGGCAATGGCACTATGTTGGATGATAGCAAGTCTGCTGGTCTTCTGGGAA
CTAGCCTTACTTGGGGTGATATGCTTCTTCCGTTCACGGCGGGCACATTCTTGTATGTTGGCACCGTGGCTGTGA
TTCCGGAGTTGCTGGAGACTGGCAAGGATAAGGGCGTTGAGGTGCGGAAGACTATCACGCAGTTCTTGGCTGTTG
CTCTTGGAGCCGGTATTATGCTTGCGTAAGTATCCATTCGCCCCGCCATGCTTTCCAGGCACAATATCACTGACA
CGCTTTATAGTATTTCTTGGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail