Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g2335.t1
Gene name
Locationscaffold_02:1567603..1569312
Strand-
Gene length (bp)1709
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 2.8E-29 13 141
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 3.2E-20 376 531
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 3.1E-15 164 269

GO

GO Term Description Terminal node
GO:0030976 thiamine pyrophosphate binding Yes
GO:0003824 catalytic activity Yes
GO:0000287 magnesium ion binding Yes
GO:0005488 binding No
GO:0050997 quaternary ammonium group binding No
GO:0043169 cation binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0019842 vitamin binding No
GO:0046872 metal ion binding No
GO:1901681 sulfur compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g2335.t1
MGPTKPNGSTSMVALSMADGYARLTGEPQAVIVHVDVGTQGLGAAVHNASCGRAPVLIFAGLSPYTIEGEMRGSR
TEYIHWIQDVPDQKQIVAQYCRYTGEIKSGKNVKQIVNRALQFATSDPQGPVYLAGAREVMEEDIEPYQLNQAVW
GPVSPAALPTSGVELIAAELAAAKRPLIITGYSGRKAQAVTELVALADSFKGIRVLDTGGSDMCFPANHPAWLGL
RYPGHEAVGTSDLILVVDCDVPWVPTQFKPSASAKIIHIDVDPLKQQIPVFYIHSMATFRADASTALKQINDYVA
SRESLQQFISSKDNITMGQRRDEEYSRRRQEISDLAVIPEGGDGASLNIHYLMAQVREGVPIDTIWAIESVTMTH
FVADQVSATQPKSWINCGGGGLGWSGGGALGIKLASDIQQGGRGKGKFVCQVVGDGTFLFSVPGSVYWIARRYGI
PVLTIVLNNKGWNAPRRSMLLVHPEGDGSRATNEDLNISFVPTPDYAGIAKAAAGGDLWAGRASTVAELARKLPE
AIQSVLNGKAAVLEAQLDGTAGKYVESS*
Coding >Pro_DTO070G2_2|g2335.t1
ATGGGACCCACCAAGCCTAACGGCAGCACTTCGATGGTGGCACTGTCCATGGCCGACGGCTACGCACGATTGACC
GGAGAGCCGCAAGCAGTAATCGTCCATGTCGATGTCGGTACGCAGGGACTCGGAGCAGCAGTTCACAACGCCTCA
TGCGGGCGCGCCCCGGTTTTGATATTTGCCGGTCTATCGCCTTACACGATCGAGGGCGAGATGCGAGGTTCACGC
ACTGAATATATCCACTGGATCCAAGATGTGCCAGACCAGAAGCAAATTGTCGCCCAGTACTGTCGGTACACGGGT
GAGATCAAGTCGGGCAAGAATGTTAAGCAGATTGTCAACCGGGCTTTGCAATTCGCAACTAGTGATCCACAGGGG
CCTGTGTATCTTGCCGGGGCGCGGGAGGTTATGGAGGAGGATATCGAGCCATACCAGCTGAACCAGGCTGTCTGG
GGTCCTGTGTCACCGGCCGCCCTACCAACCTCCGGCGTTGAGTTAATCGCAGCTGAGCTTGCAGCTGCCAAGCGC
CCTCTTATCATTACTGGATATTCCGGAAGGAAAGCCCAAGCTGTGACTGAGCTGGTCGCATTGGCAGATAGCTTC
AAGGGAATCCGTGTGCTGGACACTGGTGGTAGCGACATGTGCTTCCCTGCTAACCACCCTGCATGGTTGGGATTG
AGATATCCAGGCCATGAGGCAGTGGGAACATCTGATCTAATCCTGGTGGTAGACTGCGATGTCCCCTGGGTGCCT
ACCCAGTTCAAGCCGTCTGCGTCGGCCAAGATTATACACATTGATGTCGACCCTCTGAAGCAACAGATTCCAGTT
TTCTACATTCACTCGATGGCTACATTCCGCGCCGACGCTTCCACCGCACTCAAGCAAATCAACGATTACGTTGCT
TCTCGGGAATCTCTGCAACAATTCATTAGCTCCAAAGATAATATTACTATGGGCCAGCGCCGAGACGAGGAGTAT
TCAAGGCGTCGACAAGAGATCTCCGATCTGGCTGTTATCCCGGAGGGCGGCGACGGGGCTTCCTTGAATATCCAC
TACCTCATGGCGCAGGTCCGCGAGGGCGTTCCGATTGATACCATCTGGGCTATTGAGTCCGTGACCATGACCCAC
TTTGTTGCTGATCAGGTCTCAGCTACCCAACCTAAGTCGTGGATCAACTGTGGAGGTGGCGGTCTCGGCTGGTCC
GGCGGTGGTGCGCTTGGTATCAAGCTTGCTAGTGACATACAGCAGGGAGGACGTGGAAAGGGAAAGTTTGTCTGT
CAGGTTGTTGGTGATGGAACATTCCTCTTCTCGGTGCCTGGATCTGTGTACTGGATCGCCCGCCGCTATGGAATC
CCCGTTTTGACAATTGTGCTAAACAATAAGGGCTGGAATGCCCCCCGGCGAAGCATGCTGCTCGTTCATCCTGAA
GGGGACGGCTCTCGTGCTACGAACGAAGACCTCAATATCTCCTTTGTGCCAACGCCGGATTACGCCGGTATAGCC
AAGGCCGCTGCAGGCGGTGACTTGTGGGCTGGGCGTGCCTCGACTGTTGCTGAGCTCGCCCGGAAGCTCCCAGAA
GCTATCCAGAGTGTTCTAAACGGAAAGGCAGCGGTGCTGGAAGCACAGCTTGACGGGACCGCAGGAAAATATGTA
GAAAGCTCGTGA
Transcript >Pro_DTO070G2_2|g2335.t1
ATGGGACCCACCAAGCCTAACGGCAGCACTTCGATGGTGGCACTGTCCATGGCCGACGGCTACGCACGATTGACC
GGAGAGCCGCAAGCAGTAATCGTCCATGTCGATGTCGGTACGCAGGGACTCGGAGCAGCAGTTCACAACGCCTCA
TGCGGGCGCGCCCCGGTTTTGATATTTGCCGGTCTATCGCCTTACACGATCGAGGGCGAGATGCGAGGTTCACGC
ACTGAATATATCCACTGGATCCAAGATGTGCCAGACCAGAAGCAAATTGTCGCCCAGTACTGTCGGTACACGGGT
GAGATCAAGTCGGGCAAGAATGTTAAGCAGATTGTCAACCGGGCTTTGCAATTCGCAACTAGTGATCCACAGGGG
CCTGTGTATCTTGCCGGGGCGCGGGAGGTTATGGAGGAGGATATCGAGCCATACCAGCTGAACCAGGCTGTCTGG
GGTCCTGTGTCACCGGCCGCCCTACCAACCTCCGGCGTTGAGTTAATCGCAGCTGAGCTTGCAGCTGCCAAGCGC
CCTCTTATCATTACTGGATATTCCGGAAGGAAAGCCCAAGCTGTGACTGAGCTGGTCGCATTGGCAGATAGCTTC
AAGGGAATCCGTGTGCTGGACACTGGTGGTAGCGACATGTGCTTCCCTGCTAACCACCCTGCATGGTTGGGATTG
AGATATCCAGGCCATGAGGCAGTGGGAACATCTGATCTAATCCTGGTGGTAGACTGCGATGTCCCCTGGGTGCCT
ACCCAGTTCAAGCCGTCTGCGTCGGCCAAGATTATACACATTGATGTCGACCCTCTGAAGCAACAGATTCCAGTT
TTCTACATTCACTCGATGGCTACATTCCGCGCCGACGCTTCCACCGCACTCAAGCAAATCAACGATTACGTTGCT
TCTCGGGAATCTCTGCAACAATTCATTAGCTCCAAAGATAATATTACTATGGGCCAGCGCCGAGACGAGGAGTAT
TCAAGGCGTCGACAAGAGATCTCCGATCTGGCTGTTATCCCGGAGGGCGGCGACGGGGCTTCCTTGAATATCCAC
TACCTCATGGCGCAGGTCCGCGAGGGCGTTCCGATTGATACCATCTGGGCTATTGAGTCCGTGACCATGACCCAC
TTTGTTGCTGATCAGGTCTCAGCTACCCAACCTAAGTCGTGGATCAACTGTGGAGGTGGCGGTCTCGGCTGGTCC
GGCGGTGGTGCGCTTGGTATCAAGCTTGCTAGTGACATACAGCAGGGAGGACGTGGAAAGGGAAAGTTTGTCTGT
CAGGTTGTTGGTGATGGAACATTCCTCTTCTCGGTGCCTGGATCTGTGTACTGGATCGCCCGCCGCTATGGAATC
CCCGTTTTGACAATTGTGCTAAACAATAAGGGCTGGAATGCCCCCCGGCGAAGCATGCTGCTCGTTCATCCTGAA
GGGGACGGCTCTCGTGCTACGAACGAAGACCTCAATATCTCCTTTGTGCCAACGCCGGATTACGCCGGTATAGCC
AAGGCCGCTGCAGGCGGTGACTTGTGGGCTGGGCGTGCCTCGACTGTTGCTGAGCTCGCCCGGAAGCTCCCAGAA
GCTATCCAGAGTGTTCTAAACGGAAAGGCAGCGGTGCTGGAAGCACAGCTTGACGGGACCGCAGGAAAATATGTA
GAAAGCTCGTGA
Gene >Pro_DTO070G2_2|g2335.t1
ATGGGACCCACCAAGCCTAACGGCAGCACTTCGGTTAGAGTCGGTATGAATGTGAGCCCCGCTGACGATATGCTG
TTTAGATGGTGGCACTGTCCATGGCCGACGGCTACGCACGATTGACCGGAGAGCCGCAAGCAGTAATCGTCCATG
TCGATGTCGGTACGCAGGGACTCGGAGCAGCAGTTCACAACGCCTCATGCGGGCGCGCCCCGGTTTTGATATTTG
CCGGTCTATCGCCTTACACGATCGAGGGCGAGATGCGAGGTTCACGCACTGAATATATCCACTGGATCCAAGATG
TGCCAGACCAGAAGCAAATTGTCGCCCAGTACTGTCGGTACACGGGTGAGATCAAGTCGGGCAAGAATGTTAAGC
AGATTGTCAACCGGGCTTTGCAATTCGCAACTAGTGATCCACAGGGGCCTGTGTATCTTGCCGGGGCGCGGGAGG
TTATGGAGGAGGATATCGAGCCATACCAGCTGAACCAGGCTGTCTGGGGTCCTGTGTCACCGGCCGCCCTACCAA
CCTCCGGCGTTGAGTTAATCGCAGCTGAGCTTGCAGCTGCCAAGCGCCCTCTTATCATTACTGGATATTCCGGAA
GGAAAGCCCAAGCTGTGACTGAGCTGGTCGCATTGGCAGATAGCTTCAAGGGAATCCGTGTGCTGGACACTGGTG
GTAGCGACATGTGCTTCCCTGCTAACCACCCTGCATGGTTGGGATTGAGATATCCAGGCCATGAGGCAGTGGGAA
CATCTGATCTAATCCTGGTGGTAGACTGCGATGTCCCCTGGGTGCCTACCCAGTTCAAGCCGTCTGCGTCGGCCA
AGATTATACACATTGATGTCGACCCTCTGAAGCAACAGATTCCAGTTTTCTACATTCACTCGATGGCTACATTCC
GCGCCGACGCTTCCACCGCACTCAAGCAAATCAACGATTACGTTGCTTCTCGGGAATCTCTGCAACAATTCATTA
GCTCCAAAGATAATATTACTATGGGCCAGCGCCGAGACGAGGAGTATTCAAGGCGTCGACAAGAGATCTCCGATC
TGGCTGTTATCCCGGAGGGCGGCGACGGGGCTTCCTTGAATATCCACTACCTCATGGCGCAGGTCCGCGAGGGCG
TTCCGATTGATACCATCTGGGCTATTGAGTCCGTGACCATGACCCACTTTGTTGCTGATCAGGTCTCAGCTACCC
AACCTAAGTCGTGGATCAACTGTGGAGGTGGCGGTCTCGGCTGGTCCGGCGGTGGTGCGCTTGGTATCAAGCTTG
CTAGTGACATACAGCAGGGAGGACGTGGAAAGGGAAAGTTTGTCTGTCAGGTTGTTGGTGATGGAACATTCCTCT
TCTCGGTGCCTGGATCTGTGTACTGGATCGCCCGCCGCTATGGAATCCCCGTTTTGACAATTGTGCTAAACAATA
AGGGCTGGAATGCCCCCCGGCGAAGCATGCTGCTCGTTCATCCTGAAGGGGACGGCTCTCGTGCTACGAACGAAG
ACCTCAATATCTCCTTTGTGCCAACGCCGGATTACGCCGGTATAGCCAAGGCCGCTGCAGGCGGTGACTTGTGGG
CTGGGCGTGCCTCGACTGTTGCTGAGCTCGCCCGGAAGCTCCCAGAAGCTATCCAGAGTGTTCTAAACGGAAAGG
CAGCGGTGCTGGAAGCACAGCTTGACGGGACCGCAGGAAAATATGTAGAAAGCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail