Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g2266.t1
Gene name
Locationscaffold_02:1357357..1358194
Strand-
Gene length (bp)837
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 2.3E-11 44 129

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT32 2.3E-20 45 128

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup9105
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g3397.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g4781.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g5405.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g73.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g8403.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g3578.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g2357.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g500.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g1880.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g705.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g5040.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g1205.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g3748.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g6234.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g4355.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g6935.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g3352.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g2266.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g6452.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g4528.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g1253.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g5625.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g462.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g3005.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g4624.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g4637.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g1959.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g4851.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g1617.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g679.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g1612.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g500.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g5709.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g2266.t1
MRPISEPQIPSYLPIANPHGHYAQSSIPLKLWQKAGSTKIHDDRQRDINSWLDVNPRLRHEILTDDSADEYVREH
FANYPEVLDLYLSLPVPILKADLLRQLILYADGGIWSDLDVTCHIPIYTWIPEQFQNKTNVVVGLEFDGFQFASW
TIMTKPKTSHIVAVMKYIIDRLKASAAQYNVTTAQLNMTMISDVVEVTGPQAMTIALLQNLEKEMGVPFGRANIT
NIKEPTLFQDVLVLPNAAFSSRQAGFPADRGPYLVEHHYAGSWKNVNGGEAKS*
Coding >Pro_DTO070G2_2|g2266.t1
ATGAGGCCAATATCAGAACCACAAATACCAAGCTACCTGCCAATCGCGAATCCCCATGGTCACTACGCACAGTCC
TCAATCCCATTAAAGCTCTGGCAAAAGGCCGGTTCAACGAAAATCCACGACGACCGCCAGAGAGATATCAACAGT
TGGCTAGATGTGAACCCACGTCTACGACATGAGATTCTCACAGACGACAGTGCAGACGAGTACGTTCGTGAGCAT
TTTGCCAACTACCCAGAGGTCCTTGATCTCTATCTCTCACTTCCGGTCCCAATCCTAAAAGCCGATCTCCTTCGT
CAATTGATCTTGTACGCCGACGGAGGAATTTGGAGCGATCTTGACGTGACATGTCACATACCAATTTATACTTGG
ATCCCGGAACAATTTCAAAACAAAACAAACGTCGTCGTCGGTTTGGAATTCGACGGGTTCCAGTTCGCGAGTTGG
ACGATCATGACAAAACCTAAGACAAGCCATATCGTGGCGGTCATGAAATATATCATCGATAGACTGAAGGCATCT
GCTGCGCAGTACAATGTGACCACTGCACAACTTAACATGACGATGATCAGCGATGTGGTGGAAGTTACGGGTCCC
CAGGCCATGACTATTGCTCTATTGCAGAATCTGGAGAAGGAAATGGGCGTTCCTTTCGGCCGGGCAAATATAACC
AACATCAAAGAACCCACCCTATTTCAGGACGTACTCGTGTTGCCTAATGCGGCCTTTTCCTCTAGACAGGCTGGC
TTCCCGGCGGACAGAGGGCCTTATCTCGTTGAACACCATTACGCTGGCTCTTGGAAGAATGTCAATGGTGGCGAG
GCGAAATCTTGA
Transcript >Pro_DTO070G2_2|g2266.t1
ATGAGGCCAATATCAGAACCACAAATACCAAGCTACCTGCCAATCGCGAATCCCCATGGTCACTACGCACAGTCC
TCAATCCCATTAAAGCTCTGGCAAAAGGCCGGTTCAACGAAAATCCACGACGACCGCCAGAGAGATATCAACAGT
TGGCTAGATGTGAACCCACGTCTACGACATGAGATTCTCACAGACGACAGTGCAGACGAGTACGTTCGTGAGCAT
TTTGCCAACTACCCAGAGGTCCTTGATCTCTATCTCTCACTTCCGGTCCCAATCCTAAAAGCCGATCTCCTTCGT
CAATTGATCTTGTACGCCGACGGAGGAATTTGGAGCGATCTTGACGTGACATGTCACATACCAATTTATACTTGG
ATCCCGGAACAATTTCAAAACAAAACAAACGTCGTCGTCGGTTTGGAATTCGACGGGTTCCAGTTCGCGAGTTGG
ACGATCATGACAAAACCTAAGACAAGCCATATCGTGGCGGTCATGAAATATATCATCGATAGACTGAAGGCATCT
GCTGCGCAGTACAATGTGACCACTGCACAACTTAACATGACGATGATCAGCGATGTGGTGGAAGTTACGGGTCCC
CAGGCCATGACTATTGCTCTATTGCAGAATCTGGAGAAGGAAATGGGCGTTCCTTTCGGCCGGGCAAATATAACC
AACATCAAAGAACCCACCCTATTTCAGGACGTACTCGTGTTGCCTAATGCGGCCTTTTCCTCTAGACAGGCTGGC
TTCCCGGCGGACAGAGGGCCTTATCTCGTTGAACACCATTACGCTGGCTCTTGGAAGAATGTCAATGGTGGCGAG
GCGAAATCTTGA
Gene >Pro_DTO070G2_2|g2266.t1
ATGAGGCCAATATCAGAACCACAAATACCAAGCTACCTGCCAATCGCGAATCCCCATGGTCACTACGCACAGTCC
TCAATCCCATTAAAGCTCTGGCAAAAGGCCGGTTCAACGAAAATCCACGACGACCGCCAGAGAGATATCAACAGT
TGGCTAGATGTGAACCCACGTCTACGACATGAGATTCTCACAGACGACAGTGCAGACGAGTACGTTCGTGAGCAT
TTTGCCAACTACCCAGAGGTCCTTGATCTCTATCTCTCACTTCCGGTCCCAATCCTAAAAGCCGATCTCCTTCGT
CAATTGATCTTGTACGCCGACGGAGGAATTTGGAGCGATCTTGACGTGACATGTCACATACCAATTTATACTTGG
ATCCCGGAACAATTTCAAAACAAAACAAACGTCGTCGTCGGTTTGGAATTCGACGGGTTCCAGTTCGCGAGTTGG
ACGATCATGACAAAACCTAAGACAAGCCATATCGTGGCGGTCATGAAATATATCATCGATAGACTGAAGGCATCT
GCTGCGCAGTACAATGTGACCACTGCACAACTTAACATGACGATGATCAGCGATGTGGTGGAAGTTACGGGTCCC
CAGGCCATGACTATTGCTCTATTGCAGAATCTGGAGAAGGAAATGGGCGTTCCTTTCGGCCGGGCAAATATAACC
AACATCAAAGAACCCACCCTATTTCAGGACGTACTCGTGTTGCCTAATGCGGCCTTTTCCTCTAGACAGGCTGGC
TTCCCGGCGGACAGAGGGCCTTATCTCGTTGAACACCATTACGCTGGCTCTTGGAAGAATGTCAATGGTGGCGAG
GCGAAATCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail