Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g2230.t1
Gene name
Locationscaffold_02:1241964..1247571
Strand-
Gene length (bp)5607
Transcript length (bp)4410
Coding sequence length (bp)4410
Protein length (aa) 1470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10033 ATG13 Autophagy-related protein 13 4.5E-74 574 813
PF03583 LIP Secretory lipase 5.7E-58 132 414

GO

GO Term Description Terminal node
GO:1990316 Atg1/ULK1 kinase complex Yes
GO:0004806 triglyceride lipase activity Yes
GO:0006914 autophagy Yes
GO:0016042 lipid catabolic process Yes
GO:1902911 protein kinase complex No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:1902554 serine/threonine protein kinase complex No
GO:0005575 cellular_component No
GO:0052689 carboxylic ester hydrolase activity No
GO:0008152 metabolic process No
GO:0061919 process utilizing autophagic mechanism No
GO:0008150 biological_process No
GO:0044248 cellular catabolic process No
GO:0003674 molecular_function No
GO:1990234 transferase complex No
GO:0016787 hydrolase activity No
GO:0006629 lipid metabolic process No
GO:0009056 catabolic process No
GO:1901575 organic substance catabolic process No
GO:1902494 catalytic complex No
GO:0071704 organic substance metabolic process No
GO:0061695 transferase complex, transferring phosphorus-containing groups No
GO:0016298 lipase activity No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g2230.t1
MALSLALMVRLALVGLVVFTSIASALPAPQVPRSTVQDPDTDPFYQPPAGFASEAPGTILNQRNITAAFFGLVPV
DVEAYQLLYRTTAINGSAIATVTTVFKPKDAKLDRFVSFATAYDSSATKCQPSYTYQLGSPQDSLIASVELLIID
IYLALGYTVASPDYEGPEAAFGPGRLAGMGVLDGIRAVKSFKTLSLTDDPMVVGIGYSGGAIATGWAASLQPLYA
SELNIKGWAQGGTPANVTGTMYQLDNTAFSGLLPPAIAGLIKPSAYGASLGPFISEIITAEGQQILDAAVAECAT
ADIAAFFERSIFDTSFQTLGENFIFDPIAQSVLKQNTMAANEDETPTAPTFVYHATDDEVIPYADAKTMVNSWCN
WSANVKFTTYASGGHATTEIIAIPDVINFVQDAFAGTTASGCTTNTELGSILNPLALGVDLEPILVELIDALFNL
GDQDSKVKNDPVGHGPQSWIHRCPIAFLITDSGGDNTHIQHSPKTTMHQHPRSSAVPSPPPNLPPRPTARDVRRE
QETAPSSPTVDMGSNYARGLGLEPGPQPSEQGRNAALGKEALTRLNQIISNYHTKAALIILHSRVALPPSFNKGS
DSPRVNRWFNVELDDTDVLREPLRPWRTCDATDNRPPPLVIETYLDTKGLTNNQSLVIIDENGKRWDVRESLAAL
QGARAKPYQSENDEIILERWKIELGECSSRPPADLGSILPTVYKKSIVLFRSLFTYSKFLPAWRFSRRNKKLRQS
PALQIKYRVVDGSAARDNLPLDHLTAPLSEGSEKVVDTYGFGVTESPAGPFSVQVTYRTNCDFRVDDSEALLSSR
FMGADDEIFRPSLPSDDVNRPNPEVGSVPVERRAVESPDCTRAYGSLSTFHQVGPTTGASPISALRAMRDSGAGS
PSPTESPKRLLPSAKVLPSGRAAQIAGESGGSSFPRRPSVSFQPFKAPPLSASPALADSPLGMSPRNTSRISTGT
SADSRVMPPLSSAASARRPITIASEQAISSSNSASPKPAPISRYSSSFSHRRGRLSVGTNRLEDDNSSGRASATS
SNAQPGSGLLTEATGTSAESIHADDENISDFLKMLDSKKDLMNSSTASLQPGPRQANPTAVALARFRGMRDSNAA
LSDSMSQSMHMHRSSLSSSKQLSGVPPMVAGTSVSTASSPGKPISPHTPHTPAIRSRLSSNSVADDIETDHRSRI
PRSHHDPPLEEHSSAENTRGASSTAGAIDIPTSPRIFDPAYRRSSSAAVRRPVVTSDDDEIFPFGMRSLSLGADE
PSHATLAAAQQHTESLKSQQSPAEGRSGPSRSAAGPYRDSASLRGQMSGPTSASASSNPHVYQPRFASSRGRGYS
GGHSVSSASSSLARGANPAPHLVERDHDRDGNASGSNSGNSTLEIRRGSGQRPGAVRTLSGQAPEDDEPLLFAMS
DFGVSRRSLDEVRHGNHGGAESAAGSRRGSGRRGAGLPGFHVWS*
Coding >Pro_DTO070G2_2|g2230.t1
ATGGCATTGTCCCTTGCGCTCATGGTGCGCCTAGCCCTGGTTGGCCTCGTGGTATTCACTTCAATTGCCTCAGCC
CTGCCGGCGCCTCAAGTCCCTCGCAGCACGGTTCAGGACCCCGACACTGATCCGTTCTATCAGCCACCTGCTGGC
TTCGCATCCGAGGCGCCTGGGACAATCCTGAACCAACGCAACATCACTGCCGCGTTCTTTGGTCTCGTCCCGGTT
GACGTGGAAGCCTACCAGCTGCTTTACCGCACGACTGCAATCAATGGCTCGGCTATTGCAACAGTCACCACGGTG
TTTAAGCCGAAGGACGCTAAGCTTGATCGTTTCGTTTCCTTCGCCACGGCCTACGATAGCTCTGCGACGAAATGT
CAGCCTAGCTACACCTACCAGCTTGGTTCGCCACAGGACAGTTTGATTGCTTCGGTCGAGCTATTGATCATTGAT
ATCTACCTTGCTCTTGGTTACACCGTCGCTTCTCCTGACTATGAGGGACCCGAGGCTGCCTTTGGACCTGGTCGC
CTCGCAGGTATGGGTGTATTGGATGGCATACGTGCCGTGAAGAGCTTCAAGACGTTGAGTCTTACTGATGACCCC
ATGGTTGTCGGTATAGGCTATTCAGGTGGTGCCATTGCTACCGGATGGGCGGCCTCTCTGCAACCCCTCTACGCG
TCAGAGCTGAACATCAAGGGCTGGGCGCAGGGTGGAACTCCCGCGAACGTCACTGGCACAATGTATCAGCTTGAC
AACACAGCCTTCAGTGGCTTACTCCCCCCAGCTATTGCTGGTCTCATAAAGCCAAGCGCCTATGGTGCTTCGCTG
GGCCCTTTCATCAGCGAGATCATAACGGCTGAAGGCCAACAGATACTCGATGCCGCCGTTGCCGAATGCGCCACT
GCGGATATCGCGGCGTTCTTCGAACGGTCAATCTTCGACACTAGCTTCCAAACGCTAGGCGAAAATTTTATTTTC
GACCCGATCGCTCAGTCGGTACTAAAGCAGAACACCATGGCTGCCAACGAGGACGAGACCCCGACGGCGCCAACC
TTTGTGTACCACGCCACAGACGACGAAGTCATTCCTTATGCCGATGCCAAGACTATGGTCAATTCCTGGTGTAAC
TGGAGTGCAAATGTCAAGTTTACTACTTATGCCAGCGGTGGTCATGCGACCACTGAAATCATTGCCATTCCCGAT
GTCATCAATTTTGTCCAGGATGCCTTTGCTGGCACGACCGCAAGTGGCTGCACCACGAATACCGAGCTTGGTAGT
ATTCTTAACCCACTTGCTCTTGGTGTGGATCTTGAGCCAATTCTTGTGGAGCTCATTGATGCGCTGTTCAATCTG
GGCGATCAGGACTCGAAGGTCAAGAACGACCCCGTTGGACATGGCCCTCAGTCTTGGATCCATCGCTGCCCGATT
GCGTTCCTGATAACAGATTCCGGCGGTGATAACACTCATATCCAGCACTCCCCGAAGACCACCATGCATCAACAT
CCCCGATCATCGGCGGTGCCGTCTCCGCCGCCAAACCTTCCACCCAGACCGACAGCTCGGGACGTCCGCAGAGAA
CAGGAAACCGCCCCGAGCTCCCCAACGGTCGATATGGGGTCTAATTATGCCAGGGGGCTGGGGTTAGAGCCGGGA
CCTCAACCGTCCGAGCAGGGGAGGAATGCGGCATTGGGCAAGGAGGCCCTGACCCGGTTAAACCAGATAATATCG
AACTATCACACAAAAGCCGCTTTGATTATCCTACATTCACGAGTTGCACTGCCTCCCTCCTTTAACAAGGGCTCC
GATTCTCCTAGAGTCAACCGCTGGTTCAATGTCGAGTTAGATGATACAGATGTCCTTCGGGAACCCCTGCGACCT
TGGAGAACATGCGATGCAACGGACAACCGACCACCACCCCTCGTTATCGAAACATACTTAGACACAAAGGGCCTC
ACAAATAATCAAAGTCTGGTGATTATTGACGAGAATGGGAAGCGTTGGGATGTGCGTGAGTCGCTTGCGGCGCTT
CAGGGTGCCCGTGCAAAGCCATACCAATCGGAAAATGACGAGATTATCTTGGAGCGGTGGAAAATCGAATTGGGA
GAGTGCTCCAGCAGGCCTCCGGCAGATTTGGGCTCTATCTTGCCGACTGTGTATAAGAAAAGCATTGTGCTCTTC
CGTTCCTTGTTCACCTACTCCAAGTTCTTGCCTGCATGGAGATTCTCTAGACGCAACAAAAAGTTGCGACAGAGT
CCGGCCCTCCAGATCAAGTATCGTGTGGTAGATGGGAGCGCTGCTCGTGATAACCTCCCACTGGATCATTTGACA
GCCCCGTTGAGCGAGGGAAGCGAAAAAGTGGTGGACACATACGGCTTTGGGGTCACGGAGTCGCCCGCAGGTCCC
TTCTCAGTTCAAGTCACGTATCGGACGAACTGCGATTTCCGTGTTGACGACTCAGAAGCGCTACTGAGCTCGCGG
TTTATGGGTGCCGACGACGAGATCTTTCGTCCGTCGTTGCCTTCAGATGATGTCAACCGCCCAAATCCCGAAGTC
GGTTCTGTGCCAGTGGAGAGAAGGGCCGTTGAGAGCCCAGATTGCACACGTGCATACGGCAGTCTCTCCACCTTT
CATCAGGTTGGCCCAACAACAGGTGCAAGTCCTATATCAGCACTCCGTGCAATGAGAGATTCGGGCGCGGGATCT
CCTTCACCGACAGAGTCACCTAAGAGACTCCTCCCTTCTGCCAAAGTCCTTCCTTCAGGACGTGCGGCGCAGATT
GCTGGTGAAAGCGGAGGGTCAAGTTTCCCACGTCGTCCCTCTGTCTCATTCCAACCCTTCAAAGCTCCCCCTCTG
TCTGCTTCCCCGGCTTTAGCAGACTCTCCCCTGGGAATGTCTCCCCGCAACACGTCACGAATCTCCACAGGTACA
TCTGCCGATTCCCGCGTCATGCCGCCCCTTTCTTCTGCCGCTTCAGCGCGCAGACCTATAACCATCGCATCTGAA
CAAGCTATATCATCCTCTAATTCCGCATCCCCCAAACCTGCTCCGATATCCCGTTACAGCAGTTCCTTTAGCCAC
CGACGAGGCCGCCTTTCCGTAGGGACAAACAGACTGGAAGACGACAACTCCAGTGGCCGAGCGAGTGCGACATCA
TCCAATGCACAGCCCGGGTCCGGCCTACTTACGGAAGCTACGGGCACGAGTGCGGAGTCTATTCACGCAGATGAC
GAGAATATCTCCGACTTTTTGAAGATGCTTGATTCGAAAAAGGATCTAATGAATTCATCCACTGCATCTCTTCAA
CCTGGTCCTAGGCAGGCGAACCCCACCGCAGTAGCTCTTGCTCGCTTCCGCGGTATGCGAGATTCAAATGCCGCG
TTGTCCGACTCAATGTCACAGTCTATGCACATGCATCGCTCTTCTCTTTCTTCGAGCAAGCAATTGTCAGGGGTC
CCACCGATGGTTGCGGGCACCTCCGTCTCCACAGCTTCTTCTCCGGGCAAACCCATATCTCCCCACACTCCCCAC
ACGCCTGCTATACGATCTCGTCTAAGCTCGAACAGCGTTGCTGATGACATTGAGACCGACCACCGTTCAAGAATC
CCTCGCTCGCACCACGATCCACCACTCGAAGAACATTCCAGCGCAGAAAATACGCGAGGAGCTTCTTCTACTGCA
GGGGCTATTGATATTCCAACATCGCCGCGGATTTTCGACCCTGCTTACCGCCGCTCGAGCTCCGCAGCCGTGCGC
CGGCCAGTCGTTACCAGCGACGATGATGAAATATTCCCATTCGGCATGCGCAGCCTCAGTCTGGGGGCCGATGAG
CCCTCTCACGCCACCCTAGCTGCCGCCCAACAGCACACTGAGTCCCTGAAGAGCCAACAATCACCGGCCGAGGGT
CGAAGCGGTCCATCCCGCTCTGCAGCGGGTCCGTATCGGGACAGTGCATCCCTCCGCGGACAGATGTCTGGACCA
ACCAGCGCCTCAGCCTCCTCCAACCCCCATGTCTACCAGCCCCGGTTCGCCAGCTCCCGTGGCCGCGGCTACTCG
GGCGGACATTCCGTCAGCTCAGCATCCAGCAGCCTCGCCCGGGGCGCCAATCCCGCGCCGCATCTGGTGGAGCGC
GACCATGACCGTGATGGAAACGCCAGCGGAAGCAACAGCGGCAACTCCACGTTAGAGATCCGCCGTGGTTCCGGG
CAGCGGCCGGGCGCGGTTCGGACGCTTTCCGGACAAGCGCCCGAAGACGATGAGCCGCTGCTCTTCGCGATGAGC
GACTTTGGTGTCTCGCGGCGCAGCCTAGATGAAGTTCGACACGGGAACCACGGTGGGGCTGAATCGGCTGCTGGG
TCCCGGCGCGGGAGTGGGAGACGGGGAGCAGGGCTCCCGGGCTTCCATGTTTGGTCTTGA
Transcript >Pro_DTO070G2_2|g2230.t1
ATGGCATTGTCCCTTGCGCTCATGGTGCGCCTAGCCCTGGTTGGCCTCGTGGTATTCACTTCAATTGCCTCAGCC
CTGCCGGCGCCTCAAGTCCCTCGCAGCACGGTTCAGGACCCCGACACTGATCCGTTCTATCAGCCACCTGCTGGC
TTCGCATCCGAGGCGCCTGGGACAATCCTGAACCAACGCAACATCACTGCCGCGTTCTTTGGTCTCGTCCCGGTT
GACGTGGAAGCCTACCAGCTGCTTTACCGCACGACTGCAATCAATGGCTCGGCTATTGCAACAGTCACCACGGTG
TTTAAGCCGAAGGACGCTAAGCTTGATCGTTTCGTTTCCTTCGCCACGGCCTACGATAGCTCTGCGACGAAATGT
CAGCCTAGCTACACCTACCAGCTTGGTTCGCCACAGGACAGTTTGATTGCTTCGGTCGAGCTATTGATCATTGAT
ATCTACCTTGCTCTTGGTTACACCGTCGCTTCTCCTGACTATGAGGGACCCGAGGCTGCCTTTGGACCTGGTCGC
CTCGCAGGTATGGGTGTATTGGATGGCATACGTGCCGTGAAGAGCTTCAAGACGTTGAGTCTTACTGATGACCCC
ATGGTTGTCGGTATAGGCTATTCAGGTGGTGCCATTGCTACCGGATGGGCGGCCTCTCTGCAACCCCTCTACGCG
TCAGAGCTGAACATCAAGGGCTGGGCGCAGGGTGGAACTCCCGCGAACGTCACTGGCACAATGTATCAGCTTGAC
AACACAGCCTTCAGTGGCTTACTCCCCCCAGCTATTGCTGGTCTCATAAAGCCAAGCGCCTATGGTGCTTCGCTG
GGCCCTTTCATCAGCGAGATCATAACGGCTGAAGGCCAACAGATACTCGATGCCGCCGTTGCCGAATGCGCCACT
GCGGATATCGCGGCGTTCTTCGAACGGTCAATCTTCGACACTAGCTTCCAAACGCTAGGCGAAAATTTTATTTTC
GACCCGATCGCTCAGTCGGTACTAAAGCAGAACACCATGGCTGCCAACGAGGACGAGACCCCGACGGCGCCAACC
TTTGTGTACCACGCCACAGACGACGAAGTCATTCCTTATGCCGATGCCAAGACTATGGTCAATTCCTGGTGTAAC
TGGAGTGCAAATGTCAAGTTTACTACTTATGCCAGCGGTGGTCATGCGACCACTGAAATCATTGCCATTCCCGAT
GTCATCAATTTTGTCCAGGATGCCTTTGCTGGCACGACCGCAAGTGGCTGCACCACGAATACCGAGCTTGGTAGT
ATTCTTAACCCACTTGCTCTTGGTGTGGATCTTGAGCCAATTCTTGTGGAGCTCATTGATGCGCTGTTCAATCTG
GGCGATCAGGACTCGAAGGTCAAGAACGACCCCGTTGGACATGGCCCTCAGTCTTGGATCCATCGCTGCCCGATT
GCGTTCCTGATAACAGATTCCGGCGGTGATAACACTCATATCCAGCACTCCCCGAAGACCACCATGCATCAACAT
CCCCGATCATCGGCGGTGCCGTCTCCGCCGCCAAACCTTCCACCCAGACCGACAGCTCGGGACGTCCGCAGAGAA
CAGGAAACCGCCCCGAGCTCCCCAACGGTCGATATGGGGTCTAATTATGCCAGGGGGCTGGGGTTAGAGCCGGGA
CCTCAACCGTCCGAGCAGGGGAGGAATGCGGCATTGGGCAAGGAGGCCCTGACCCGGTTAAACCAGATAATATCG
AACTATCACACAAAAGCCGCTTTGATTATCCTACATTCACGAGTTGCACTGCCTCCCTCCTTTAACAAGGGCTCC
GATTCTCCTAGAGTCAACCGCTGGTTCAATGTCGAGTTAGATGATACAGATGTCCTTCGGGAACCCCTGCGACCT
TGGAGAACATGCGATGCAACGGACAACCGACCACCACCCCTCGTTATCGAAACATACTTAGACACAAAGGGCCTC
ACAAATAATCAAAGTCTGGTGATTATTGACGAGAATGGGAAGCGTTGGGATGTGCGTGAGTCGCTTGCGGCGCTT
CAGGGTGCCCGTGCAAAGCCATACCAATCGGAAAATGACGAGATTATCTTGGAGCGGTGGAAAATCGAATTGGGA
GAGTGCTCCAGCAGGCCTCCGGCAGATTTGGGCTCTATCTTGCCGACTGTGTATAAGAAAAGCATTGTGCTCTTC
CGTTCCTTGTTCACCTACTCCAAGTTCTTGCCTGCATGGAGATTCTCTAGACGCAACAAAAAGTTGCGACAGAGT
CCGGCCCTCCAGATCAAGTATCGTGTGGTAGATGGGAGCGCTGCTCGTGATAACCTCCCACTGGATCATTTGACA
GCCCCGTTGAGCGAGGGAAGCGAAAAAGTGGTGGACACATACGGCTTTGGGGTCACGGAGTCGCCCGCAGGTCCC
TTCTCAGTTCAAGTCACGTATCGGACGAACTGCGATTTCCGTGTTGACGACTCAGAAGCGCTACTGAGCTCGCGG
TTTATGGGTGCCGACGACGAGATCTTTCGTCCGTCGTTGCCTTCAGATGATGTCAACCGCCCAAATCCCGAAGTC
GGTTCTGTGCCAGTGGAGAGAAGGGCCGTTGAGAGCCCAGATTGCACACGTGCATACGGCAGTCTCTCCACCTTT
CATCAGGTTGGCCCAACAACAGGTGCAAGTCCTATATCAGCACTCCGTGCAATGAGAGATTCGGGCGCGGGATCT
CCTTCACCGACAGAGTCACCTAAGAGACTCCTCCCTTCTGCCAAAGTCCTTCCTTCAGGACGTGCGGCGCAGATT
GCTGGTGAAAGCGGAGGGTCAAGTTTCCCACGTCGTCCCTCTGTCTCATTCCAACCCTTCAAAGCTCCCCCTCTG
TCTGCTTCCCCGGCTTTAGCAGACTCTCCCCTGGGAATGTCTCCCCGCAACACGTCACGAATCTCCACAGGTACA
TCTGCCGATTCCCGCGTCATGCCGCCCCTTTCTTCTGCCGCTTCAGCGCGCAGACCTATAACCATCGCATCTGAA
CAAGCTATATCATCCTCTAATTCCGCATCCCCCAAACCTGCTCCGATATCCCGTTACAGCAGTTCCTTTAGCCAC
CGACGAGGCCGCCTTTCCGTAGGGACAAACAGACTGGAAGACGACAACTCCAGTGGCCGAGCGAGTGCGACATCA
TCCAATGCACAGCCCGGGTCCGGCCTACTTACGGAAGCTACGGGCACGAGTGCGGAGTCTATTCACGCAGATGAC
GAGAATATCTCCGACTTTTTGAAGATGCTTGATTCGAAAAAGGATCTAATGAATTCATCCACTGCATCTCTTCAA
CCTGGTCCTAGGCAGGCGAACCCCACCGCAGTAGCTCTTGCTCGCTTCCGCGGTATGCGAGATTCAAATGCCGCG
TTGTCCGACTCAATGTCACAGTCTATGCACATGCATCGCTCTTCTCTTTCTTCGAGCAAGCAATTGTCAGGGGTC
CCACCGATGGTTGCGGGCACCTCCGTCTCCACAGCTTCTTCTCCGGGCAAACCCATATCTCCCCACACTCCCCAC
ACGCCTGCTATACGATCTCGTCTAAGCTCGAACAGCGTTGCTGATGACATTGAGACCGACCACCGTTCAAGAATC
CCTCGCTCGCACCACGATCCACCACTCGAAGAACATTCCAGCGCAGAAAATACGCGAGGAGCTTCTTCTACTGCA
GGGGCTATTGATATTCCAACATCGCCGCGGATTTTCGACCCTGCTTACCGCCGCTCGAGCTCCGCAGCCGTGCGC
CGGCCAGTCGTTACCAGCGACGATGATGAAATATTCCCATTCGGCATGCGCAGCCTCAGTCTGGGGGCCGATGAG
CCCTCTCACGCCACCCTAGCTGCCGCCCAACAGCACACTGAGTCCCTGAAGAGCCAACAATCACCGGCCGAGGGT
CGAAGCGGTCCATCCCGCTCTGCAGCGGGTCCGTATCGGGACAGTGCATCCCTCCGCGGACAGATGTCTGGACCA
ACCAGCGCCTCAGCCTCCTCCAACCCCCATGTCTACCAGCCCCGGTTCGCCAGCTCCCGTGGCCGCGGCTACTCG
GGCGGACATTCCGTCAGCTCAGCATCCAGCAGCCTCGCCCGGGGCGCCAATCCCGCGCCGCATCTGGTGGAGCGC
GACCATGACCGTGATGGAAACGCCAGCGGAAGCAACAGCGGCAACTCCACGTTAGAGATCCGCCGTGGTTCCGGG
CAGCGGCCGGGCGCGGTTCGGACGCTTTCCGGACAAGCGCCCGAAGACGATGAGCCGCTGCTCTTCGCGATGAGC
GACTTTGGTGTCTCGCGGCGCAGCCTAGATGAAGTTCGACACGGGAACCACGGTGGGGCTGAATCGGCTGCTGGG
TCCCGGCGCGGGAGTGGGAGACGGGGAGCAGGGCTCCCGGGCTTCCATGTTTGGTCTTGA
Gene >Pro_DTO070G2_2|g2230.t1
ATGGCATTGTCCCTTGCGCTCATGGTGCGCCTAGCCCTGGTTGGCCTCGTGGTATTCACTTCAATTGCCTCAGCC
CTGCCGGCGCCTCAAGTCCCTCGCAGCACGGTTCAGGACCCCGACACTGATCCGTTCTATCAGCCACCTGCTGGC
TTCGCATCCGAGGCGCCTGGGACAATCCTGAACCAACGCAACATCACTGCCGCGTTCTTTGGTCTCGTCCCGGTT
GACGTGGAAGCCTACCAGCTGCTTTACCGCACGACTGCAATCAATGGCTCGGCTATTGCAACAGTCACCACGGTG
TTTAAGCCGAAGGACGCTAAGCTTGATCGTTTCGTTTCCTTCGCCACGGCCTACGATAGCTCTGCGACGAAATGT
CAGCCTAGCTACACCTACCAGCTTGGTTCGCCACAGGACAGTTTGATTGCTTCGGTCGAGCTATTGATCATTGAT
ATCTACCTTGCTCTTGGTTACACCGTCGCTTCTCCTGACTATGAGGGACCCGAGGCTGCCTTTGGACCTGGTCGC
CTCGCAGGTATGGGTGTATTGGATGGCATACGTGCCGTGAAGAGCTTCAAGACGTTGAGTCTTACTGATGACCCC
ATGGTTGTCGGTATAGGCTATTCAGGTGGTGCCATTGCTACCGGATGGGCGGCCTCTCTGCAACCCCTCTACGCG
TCAGAGCTGAACATCAAGGGCTGGGCGCAGGGTGGAACTCCCGCGAACGTCACTGGCACAATGTATCAGCTTGAC
AACACAGCCTTCAGTGGCTTACTCCCCCCAGCTATTGCTGGTCTCATAAAGCCAAGCGCCTATGGTGCTTCGCTG
GGCCCTTTCATCAGCGAGATCATAACGGCTGAAGGCCAACAGATACTCGATGCCGCCGTTGCCGAATGCGCCACT
GCGGATATCGCGGCGTTCTTCGAACGGTCAATCTTCGACACTAGCTTCCAAACGCTAGGCGAAAATTTTATTTTC
GACCCGATCGCTCAGTCGGTACTAAAGCAGAACACCATGGCTGCCAACGAGGACGAGACCCCGACGGCGCCAACC
TTTGTGTACCACGCCACAGACGACGAAGTCATTCCTTATGCCGATGCCAAGACTATGGTCAATTCCTGGTGTAAC
TGGAGTGCAAATGTCAAGTTTACTACTTATGCCAGCGGTGGTCATGCGACCACTGAAATCATTGCCATTCCCGAT
GTCATCAATTTTGTCCAGGATGCCTTTGCTGGCACGACCGCAAGTGGCTGCACCACGAATACCGAGCTTGGTAGT
ATTCTTAACCCACTTGCTCTTGGTGTGGATCTTGAGCCAATTCTTGTGGAGCTCATTGATGCGCTGTTCAATCTG
GGCGATCAGGACTCGAAGGTCAAGAACGACCCCGTTGGAGTGCTCGGCACAAGCCTTTAAGCGAATGCTGACATC
TATTATCATTGGTCCTGATGAGCGTTGAGGGTTTGAGCCGCAACTGTTTCTGATATGCACATGGTTATTCGCTCT
GCCACCTTTGGTGTCTTTGTTTCCTTTGGCTAGGCTTTGGTATCCTTTGTGGGACATTATAACCTTTTCTGTCAG
CACATAATGTTTCTCACCAACAATGAGAAGGCAGACTTCCGAGTCGAGCTTGTGTTGATCAATGGAATGAAGTCC
ACAGGATATGACGTTGGATCAGATAACGGTGTAACCTGCCAAAATATAGTATGGGGAAATCTTGGAAGATGGCAA
AGTACTCAGATATAAAGGATCCATCAGCTGCCTATACCTGGCTGTCTGTAGCCTCTAAGTAGAACCTCTTGATAT
CACGCCTTGTAAGTCGTGATCAAGCGCTTATCGGTTCCAGGGGACCTTGCCCCGGGTACGGCGATCCTTGCGACC
GTGCATGACACCCGGCTTGTCCAACAGCCTGTTTCCAGGTAAAAGGAAGTTATACAAGTGAAAGGAGAACAGGAG
CCTAGTTTATCAAGAAGATAGGCAGCCAACCCCCCGTGTTTGCATCATCTGTGTGGCGTTCTAGGCTGACTAGGA
CACTCGAGACCTGTCGAGTCACCGGATGTGCGTCACAGACGAACTATCTTCATTATCACACCCCTTCTCTCTCTC
TTTCTCCGCATCCACCTGCTTTCTCATTCTTTTCTTACGAGCTTTATCATATTTCTCTCGCTTCTCTACACCCCT
CACGGTGATTTTATCCAACTGCATTTGCCCGTGCGGAGAAGCTCTAGACCTGCCCCGAAGGTCCCAGGCCGGAGT
CAACCCCAGACCACATGCTAGGCGCCCATTGTCTCATTGTGAATCATTTAGCGTCTCAGATTCAGGAACATTCTT
AGAAGATTATCATCACCTTCTCTGTTAGCATGGCCCTCAGTCTTGGATCCATCGCTGCCCGATTGCGTTCCTGAT
AACAGATTCCGGCGGTGATAACACTCATATCCAGCACTCCCCGGTAATGCCGTTCTTACCTCTTGTTCGCATGCA
TGTCGATGGTCGCTAACCACGGTGTCGCAACTAGAAGACCACCATGCATCAACATCCCCGATCATCGGCGGTGCC
GTCTCCGCCGCCAAACCTTCCACCCAGACCGACAGCTCGGGACGTCCGCAGAGAACAGGAAACCGCCCCGAGCTC
CCCAACGGTCGATATGGGGTCTAATTATGCCAGGGGGCTGGGGTTAGAGCCGGGACCTCAACCGTCCGAGCAGGG
GAGGAATGCGGCATTGGGCAAGGAGGCCCTGACCCGGTTAAACCAGATAATATCGGTATCGTCATTCAGATCGCC
CCTCTCATGGCTTATCAGGATAGCTCATTGACGGCTAATCTCCTTTTCAACAGAACTATCACACAAAAGCCGCTT
TGATTATCCTACATTCACGAGTTGCACTGCCTCCCTCCTTTAACAAGGGCTCCGATTCTCCTAGAGTCAACCGCT
GGGTATGTTTCCAAGTCATGGTCGGATTCGCGATGCTTTTTGGGATATCAAGGCACATGAAAGTGGCAGGCGCTA
ACTCTGTTTGTTTCCCTCCAGTTCAATGTCGAGTTAGATGATACAGATGTCCTTCGGGAACCCCTGCGACCTTGG
AGAACATGCGATGCAACGGACAACCGACCACCACCCCTCGTTATCGAAACATACTTAGACACAAAGGGCCTCACA
AATAATCAAAGTCTGGTGATTATTGACGAGAATGGGAAGCGTTGGGATGTGCGTGAGTCGCTTGCGGCGCTTCAG
GGTGCCCGTGCAAAGCCATACCAATCGGAAAATGACGAGATTATCTTGGAGCGGTGGAAAATCGAATTGGGAGAG
TGCTCCAGCAGGCCTCCGGCAGATTTGGGCTCTATCTTGCCGACTGTGTATAAGAAAAGCATTGTGCTCTTCCGT
TCCTTGTTCACCTACTCCAAGTTCTTGCCTGCATGGAGATTCTCTAGACGCAACAAAAAGTTGCGACAGAGTCCG
GCCCTCCAGATCAAGTATCGTGTGGTAGATGGGAGCGCTGCTCGTGATAACCTCCCACTGGATCATTTGACAGCC
CCGTTGAGCGAGGGAAGCGAAAAAGTGGTGGACACATACGGCTTTGGGGTCACGGAGTCGCCCGCAGGTCCCTTC
TCAGTTCAAGTCACGTATCGGACGAACTGCGATTTCCGTGTTGACGACTCAGAAGCGCTACTGAGCTCGCGGTTT
ATGGGTGCCGACGACGAGATCTTTCGTCCGTCGTTGCCTTCAGATGATGTCAACCGCCCAAATCCCGAAGTCGGT
TCTGTGCCAGTGGAGAGAAGGGCCGTTGAGAGCCCAGATTGCACACGTGCATACGGCAGTCTCTCCACCTTTCAT
CAGGTTGGCCCAACAACAGGTGCAAGTCCTATATCAGCACTCCGTGCAATGAGAGATTCGGGCGCGGGATCTCCT
TCACCGACAGAGTCACCTAAGAGACTCCTCCCTTCTGCCAAAGTCCTTCCTTCAGGACGTGCGGCGCAGATTGCT
GGTGAAAGCGGAGGGTCAAGTTTCCCACGTCGTCCCTCTGTCTCATTCCAACCCTTCAAAGCTCCCCCTCTGTCT
GCTTCCCCGGCTTTAGCAGACTCTCCCCTGGGAATGTCTCCCCGCAACACGTCACGAATCTCCACAGGTACATCT
GCCGATTCCCGCGTCATGCCGCCCCTTTCTTCTGCCGCTTCAGCGCGCAGACCTATAACCATCGCATCTGAACAA
GCTATATCATCCTCTAATTCCGCATCCCCCAAACCTGCTCCGATATCCCGTTACAGCAGTTCCTTTAGCCACCGA
CGAGGCCGCCTTTCCGTAGGGACAAACAGACTGGAAGACGACAACTCCAGTGGCCGAGCGAGTGCGACATCATCC
AATGCACAGCCCGGGTCCGGCCTACTTACGGAAGCTACGGGCACGAGTGCGGAGTCTATTCACGCAGATGACGAG
AATATCTCCGACTTTTTGAAGATGCTTGATTCGAAAAAGGATCTAATGAATTCATCCACTGCATCTCTTCAACCT
GGTCCTAGGCAGGCGAACCCCACCGCAGTAGCTCTTGCTCGCTTCCGCGGTATGCGAGATTCAAATGCCGCGTTG
TCCGACTCAATGTCACAGTCTATGCACATGCATCGCTCTTCTCTTTCTTCGAGCAAGCAATTGTCAGGGGTCCCA
CCGATGGTTGCGGGCACCTCCGTCTCCACAGCTTCTTCTCCGGGCAAACCCATATCTCCCCACACTCCCCACACG
CCTGCTATACGATCTCGTCTAAGCTCGAACAGCGTTGCTGATGACATTGAGACCGACCACCGTTCAAGAATCCCT
CGCTCGCACCACGATCCACCACTCGAAGAACATTCCAGCGCAGAAAATACGCGAGGAGCTTCTTCTACTGCAGGG
GCTATTGATATTCCAACATCGCCGCGGATTTTCGACCCTGCTTACCGCCGCTCGAGCTCCGCAGCCGTGCGCCGG
CCAGTCGTTACCAGCGACGATGATGAAATATTCCCATTCGGCATGCGCAGCCTCAGTCTGGGGGCCGATGAGCCC
TCTCACGCCACCCTAGCTGCCGCCCAACAGCACACTGAGTCCCTGAAGAGCCAACAATCACCGGCCGAGGGTCGA
AGCGGTCCATCCCGCTCTGCAGCGGGTCCGTATCGGGACAGTGCATCCCTCCGCGGACAGATGTCTGGACCAACC
AGCGCCTCAGCCTCCTCCAACCCCCATGTCTACCAGCCCCGGTTCGCCAGCTCCCGTGGCCGCGGCTACTCGGGC
GGACATTCCGTCAGCTCAGCATCCAGCAGCCTCGCCCGGGGCGCCAATCCCGCGCCGCATCTGGTGGAGCGCGAC
CATGACCGTGATGGAAACGCCAGCGGAAGCAACAGCGGCAACTCCACGTTAGAGATCCGCCGTGGTTCCGGGCAG
CGGCCGGGCGCGGTTCGGACGCTTTCCGGACAAGCGCCCGAAGACGATGAGCCGCTGCTCTTCGCGATGAGCGAC
TTTGGTGTCTCGCGGCGCAGCCTAGATGAAGTTCGACACGGGAACCACGGTGGGGCTGAATCGGCTGCTGGGTCC
CGGCGCGGGAGTGGGAGACGGGGAGCAGGGCTCCCGGGCTTCCATGTTTGGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail