Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g2027.t1
Gene name
Locationscaffold_02:710583..712400
Strand-
Gene length (bp)1817
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04163 Tht1 Tht1-like nuclear fusion protein 4.9E-06 166 214

GO

GO Term Description Terminal node
GO:0048288 nuclear membrane fusion involved in karyogamy Yes
GO:0000742 karyogamy involved in conjugation with cellular fusion Yes
GO:0006997 nucleus organization No
GO:0061025 membrane fusion No
GO:0022414 reproductive process No
GO:0071840 cellular component organization or biogenesis No
GO:0016043 cellular component organization No
GO:0061024 membrane organization No
GO:0006996 organelle organization No
GO:0000740 nuclear membrane fusion No
GO:0009987 cellular process No
GO:0071763 nuclear membrane organization No
GO:0000741 karyogamy No
GO:0048284 organelle fusion No
GO:0090174 organelle membrane fusion No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 467 489 22
2 496 514 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g2027.t1
MRATDRFQVIAYIFLALTHLGRASVSQHNVPILATRPPDIDTVSFLSSRAQDQDSIFNEAVKILDSMQSSPSCNR
LAATKLVNSCQTFSDGKDGTQTDNPETLDVLRSVYAVRLALCEIDGAGTQMPPSCLPVTVSPPPQKNRFGFVSRH
RGPDPMSDEVPKELLEQCLRTLESRPQWWTSYSNSRQNALVICHASRIETEKEELIELQRSIAKSSLKLNNGLQE
ALRNAIAQSAQQQSFIHALQSLQGKIVTDMEATDSVFKRTFGKFLREIEAGIWSLQDSISEALSNVRAGTGVLEG
DIRNLSTQVGALQQALRSAHQDAMTRSRETLLAQETNVVAQKNLASSLHLSLESLLDSDMDKLYQGMQRFDAAME
WLASRMNMILEQETRMTERLQNMETFIQRSESKASELQKAQDQQTEALSAQSRAQEAIQFDAQVSQALLAKTSVA
AANLQSVIDDAALKFKHVPGFGIGGSSAWSICAVLLIVLAAQNLKIAIALIFLILGHSVALIIFKFL*
Coding >Pro_DTO070G2_2|g2027.t1
ATGAGGGCAACCGATCGCTTCCAAGTGATTGCATATATCTTCCTGGCACTTACACACCTCGGTCGAGCAAGTGTC
TCCCAACACAATGTCCCAATTCTTGCAACCAGACCACCGGACATCGACACGGTCTCTTTCCTCAGTTCCCGGGCG
CAAGACCAAGACAGCATCTTCAACGAAGCCGTCAAAATCCTGGACTCGATGCAATCTTCACCCTCGTGCAACCGG
CTTGCAGCGACAAAACTAGTGAACTCGTGCCAAACATTCAGCGATGGCAAGGACGGCACGCAGACGGATAACCCA
GAGACTCTCGACGTTCTACGATCCGTCTATGCAGTACGCCTGGCATTGTGTGAGATCGACGGTGCTGGTACCCAA
ATGCCTCCCTCGTGCCTCCCTGTTACTGTCTCGCCACCTCCACAGAAGAATCGATTTGGCTTTGTGAGTCGACAC
AGAGGCCCCGACCCCATGTCGGATGAAGTTCCAAAAGAATTATTGGAGCAATGTCTGAGGACACTTGAGTCACGA
CCCCAGTGGTGGACCTCTTACAGCAACAGCCGACAGAATGCTCTTGTGATCTGCCATGCCTCGCGAATCGAGACG
GAGAAAGAGGAGCTTATTGAGCTTCAACGATCCATTGCCAAGAGCAGTCTCAAGCTCAACAATGGGCTTCAAGAG
GCGTTGCGAAATGCAATTGCACAGTCTGCGCAGCAGCAATCATTCATACATGCTCTTCAGTCTCTGCAAGGGAAG
ATCGTGACCGATATGGAAGCGACAGACTCTGTGTTCAAACGAACATTCGGCAAATTCCTTCGAGAAATCGAAGCT
GGAATCTGGTCGCTGCAAGATTCTATATCTGAGGCTTTGTCGAATGTGCGGGCTGGAACTGGGGTCCTCGAAGGG
GATATCCGGAACTTATCTACTCAAGTTGGAGCACTTCAACAGGCTCTACGGAGTGCACATCAAGATGCAATGACT
AGAAGCCGAGAGACGTTGCTAGCTCAAGAAACCAATGTTGTCGCCCAGAAGAATCTCGCATCATCTTTACACCTG
TCGCTCGAGTCACTTCTGGACTCAGACATGGACAAACTGTACCAAGGCATGCAGAGATTCGATGCTGCTATGGAA
TGGTTGGCCAGCCGGATGAACATGATTCTTGAGCAAGAAACCAGGATGACAGAGCGACTTCAAAACATGGAAACC
TTTATACAAAGATCCGAATCGAAGGCAAGCGAGCTACAAAAGGCGCAGGACCAACAAACAGAAGCACTATCTGCC
CAATCGCGGGCCCAGGAGGCCATTCAATTCGATGCGCAAGTGTCGCAAGCTTTGCTGGCCAAAACTAGTGTTGCT
GCTGCCAATTTACAATCCGTCATCGACGATGCAGCGTTAAAGTTCAAGCATGTCCCGGGTTTCGGCATTGGGGGA
TCCTCGGCATGGTCTATCTGCGCCGTCCTACTCATCGTCCTTGCCGCCCAGAACCTTAAGATTGCAATTGCTTTA
ATTTTTCTCATTTTGGGCCATTCTGTTGCCCTTATTATCTTCAAATTTCTCTAG
Transcript >Pro_DTO070G2_2|g2027.t1
ATGAGGGCAACCGATCGCTTCCAAGTGATTGCATATATCTTCCTGGCACTTACACACCTCGGTCGAGCAAGTGTC
TCCCAACACAATGTCCCAATTCTTGCAACCAGACCACCGGACATCGACACGGTCTCTTTCCTCAGTTCCCGGGCG
CAAGACCAAGACAGCATCTTCAACGAAGCCGTCAAAATCCTGGACTCGATGCAATCTTCACCCTCGTGCAACCGG
CTTGCAGCGACAAAACTAGTGAACTCGTGCCAAACATTCAGCGATGGCAAGGACGGCACGCAGACGGATAACCCA
GAGACTCTCGACGTTCTACGATCCGTCTATGCAGTACGCCTGGCATTGTGTGAGATCGACGGTGCTGGTACCCAA
ATGCCTCCCTCGTGCCTCCCTGTTACTGTCTCGCCACCTCCACAGAAGAATCGATTTGGCTTTGTGAGTCGACAC
AGAGGCCCCGACCCCATGTCGGATGAAGTTCCAAAAGAATTATTGGAGCAATGTCTGAGGACACTTGAGTCACGA
CCCCAGTGGTGGACCTCTTACAGCAACAGCCGACAGAATGCTCTTGTGATCTGCCATGCCTCGCGAATCGAGACG
GAGAAAGAGGAGCTTATTGAGCTTCAACGATCCATTGCCAAGAGCAGTCTCAAGCTCAACAATGGGCTTCAAGAG
GCGTTGCGAAATGCAATTGCACAGTCTGCGCAGCAGCAATCATTCATACATGCTCTTCAGTCTCTGCAAGGGAAG
ATCGTGACCGATATGGAAGCGACAGACTCTGTGTTCAAACGAACATTCGGCAAATTCCTTCGAGAAATCGAAGCT
GGAATCTGGTCGCTGCAAGATTCTATATCTGAGGCTTTGTCGAATGTGCGGGCTGGAACTGGGGTCCTCGAAGGG
GATATCCGGAACTTATCTACTCAAGTTGGAGCACTTCAACAGGCTCTACGGAGTGCACATCAAGATGCAATGACT
AGAAGCCGAGAGACGTTGCTAGCTCAAGAAACCAATGTTGTCGCCCAGAAGAATCTCGCATCATCTTTACACCTG
TCGCTCGAGTCACTTCTGGACTCAGACATGGACAAACTGTACCAAGGCATGCAGAGATTCGATGCTGCTATGGAA
TGGTTGGCCAGCCGGATGAACATGATTCTTGAGCAAGAAACCAGGATGACAGAGCGACTTCAAAACATGGAAACC
TTTATACAAAGATCCGAATCGAAGGCAAGCGAGCTACAAAAGGCGCAGGACCAACAAACAGAAGCACTATCTGCC
CAATCGCGGGCCCAGGAGGCCATTCAATTCGATGCGCAAGTGTCGCAAGCTTTGCTGGCCAAAACTAGTGTTGCT
GCTGCCAATTTACAATCCGTCATCGACGATGCAGCGTTAAAGTTCAAGCATGTCCCGGGTTTCGGCATTGGGGGA
TCCTCGGCATGGTCTATCTGCGCCGTCCTACTCATCGTCCTTGCCGCCCAGAACCTTAAGATTGCAATTGCTTTA
ATTTTTCTCATTTTGGGCCATTCTGTTGCCCTTATTATCTTCAAATTTCTCTAG
Gene >Pro_DTO070G2_2|g2027.t1
ATGAGGGCAACCGATCGCTTCCAAGTGATTGCATATATCTTCCTGGCACTTACACACCTCGGTCGAGCAAGTGTC
TCCCAACACAGTAAGCCACTCAGATACGTCTCAAATCATTTTACTGACATAAGAAGATGTCCCAATTCTTGCAAC
CAGACCACCGGACATCGACACGGTCTCTTTCCTCAGTTCCCGGGCGCAAGACCAAGACAGCATCTTCAACGAAGC
CGTCAAAATCCTGGACTCGATGCAATCTTCACCCTCGTGCAACCGGCTTGCAGCGACAAAACTAGTGAACTCGTG
CCAAACATTCAGCGATGGCAAGGACGGCACGCAGACGGATAACCCAGAGACTCTCGACGTTCTACGATCCGTCTA
TGCAGTACGCCTGGCATTGTGTGAGATCGACGGTGCTGGTACCCAAATGCCTCCCTCGTGCCTCCCTGTTACTGT
CTCGCCACCTCCACAGAAGAATCGATTTGGCTTTGTGAGTCGACACAGAGGCCCCGACCCCATGTCGGATGAAGT
TCCAAAAGAATTATTGGAGCAATGTCTGAGGACACTTGAGTCACGACCCCAGTGGTGGACCTCTTACAGCAACAG
CCGACAGAATGCTCTTGTGATCTGCCATGCCTCGCGAATCGAGACGGAGAAAGAGGAGCTTATTGAGCTTCAACG
ATCCATTGCCAAGAGCAGTCTCAAGCTCAACAATGGGCTTCAAGAGGCGTTGCGAAATGCAATTGCACAGTCTGC
GCAGCAGCAATCATTCATACATGCTCTTCAGTCTCTGCAAGGGAAGATCGTGACCGATATGGAAGCGACAGACTC
TGTGTTCAAACGAACATTCGGCAAATTCCTTCGAGAAATCGAAGCTGGAATCTGGTCGCTGCAAGATTCTATATC
TGAGGCTTTGTCGAATGTGCGGGCTGGAACTGGGGTCCTCGAAGGGGTACAATTCGAGCAGCTGAATGAGTTGAA
ACATGTACTAAAATTTCAACCAGGATATCCGGAACTTATCTACTCAAGTTGGAGCACTTCAACAGGCTCTACGGA
GTGCACATCAAGATGCAATGACTAGAAGCCGAGAGACGTTGCTAGCTCAAGAAACCAATGTTGTCGCCCAGAAGA
ATCTCGCATCATCTTTACACCTGTCGCTCGAGTCACTTCTGGACTCAGACATGGACAAACTGTACCAAGGCATGC
AGAGATTCGATGCTGCTATGGTGTGTGAAATATACATTTACCATGTAGTGACACTATGAGACTAATCTCTTGCCC
CTTTTTGTAGGAATGGTTGGCCAGCCGGATGAACATGATTCTTGAGCAAGAAACCAGGATGACAGAGGTACGAGT
ACATTCCTACATACCGGCTTTCTCACTGACTTTGAAAGCGACTTCAAAACATGGAAACCTTTATACAAAGATCCG
AATCGAAGGCAAGCGAGCTACAAAAGGCGCAGGACCAACAAACAGAAGCACTATCTGCCCAATCGCGGGCCCAGG
AGGCCATTCAATTCGATGCGCAAGTGTCGCAAGCTTTGCTGGCCAAAACTAGTGTTGCTGCTGCCAATTTACAAT
CCGTCATCGACGATGCAGCGTTAAAGTTCAAGCATGTCCCGGGTTTCGGCATTGGGGGATCCTCGGCATGGTCTA
TCTGCGCCGTCCTACTCATCGTCCTTGCCGCCCAGAACCTTAAGATTGCAATTGCTTTAATTTTTCTCATTTTGG
GTAGGTGTGTTCTTCATGATCAAGAGTGATTGGTGCTAATATAAGGAGGATTAGGCCATTCTGTTGCCCTTATTA
TCTTCAAATTTCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail