Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g2024.t1
Gene name
Locationscaffold_02:706759..707450
Strand-
Gene length (bp)691
Transcript length (bp)498
Coding sequence length (bp)498
Protein length (aa) 166

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15454 LAMTOR Late endosomal/lysosomal adaptor and MAPK and MTOR activator 2.5E-20 19 89

GO

GO Term Description Terminal node
GO:0001919 regulation of receptor recycling Yes
GO:0071986 Ragulator complex Yes
GO:0043410 positive regulation of MAPK cascade Yes
GO:0031902 late endosome membrane Yes
GO:0032008 positive regulation of TOR signaling Yes
GO:0016197 endosomal transport Yes
GO:0045121 membrane raft Yes
GO:0007040 lysosome organization Yes
GO:0042632 cholesterol homeostasis Yes
GO:0071230 cellular response to amino acid stimulus Yes
GO:0032006 regulation of TOR signaling No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0009967 positive regulation of signal transduction No
GO:0001101 response to acid chemical No
GO:0016192 vesicle-mediated transport No
GO:0032045 guanyl-nucleotide exchange factor complex No
GO:0051649 establishment of localization in cell No
GO:0012506 vesicle membrane No
GO:0008150 biological_process No
GO:0009719 response to endogenous stimulus No
GO:0080171 lytic vacuole organization No
GO:0110165 cellular anatomical entity No
GO:0050794 regulation of cellular process No
GO:0050896 response to stimulus No
GO:0071310 cellular response to organic substance No
GO:0023051 regulation of signaling No
GO:0032991 protein-containing complex No
GO:0006996 organelle organization No
GO:0048878 chemical homeostasis No
GO:0043408 regulation of MAPK cascade No
GO:0098588 bounding membrane of organelle No
GO:0065008 regulation of biological quality No
GO:1902531 regulation of intracellular signal transduction No
GO:0023056 positive regulation of signaling No
GO:0030659 cytoplasmic vesicle membrane No
GO:0098857 membrane microdomain No
GO:0050789 regulation of biological process No
GO:0051179 localization No
GO:0051641 cellular localization No
GO:0048583 regulation of response to stimulus No
GO:0019222 regulation of metabolic process No
GO:0009966 regulation of signal transduction No
GO:0071495 cellular response to endogenous stimulus No
GO:0071840 cellular component organization or biogenesis No
GO:0010033 response to organic substance No
GO:0046907 intracellular transport No
GO:0031323 regulation of cellular metabolic process No
GO:1901701 cellular response to oxygen-containing compound No
GO:0031090 organelle membrane No
GO:0016043 cellular component organization No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010647 positive regulation of cell communication No
GO:0051716 cellular response to stimulus No
GO:0007033 vacuole organization No
GO:0010008 endosome membrane No
GO:0051234 establishment of localization No
GO:1901698 response to nitrogen compound No
GO:0048522 positive regulation of cellular process No
GO:1902533 positive regulation of intracellular signal transduction No
GO:0065007 biological regulation No
GO:0010243 response to organonitrogen compound No
GO:1901700 response to oxygen-containing compound No
GO:0140535 intracellular protein-containing complex No
GO:0048518 positive regulation of biological process No
GO:0016020 membrane No
GO:0098796 membrane protein complex No
GO:0010646 regulation of cell communication No
GO:0048584 positive regulation of response to stimulus No
GO:1901699 cellular response to nitrogen compound No
GO:0042592 homeostatic process No
GO:0009987 cellular process No
GO:0042221 response to chemical No
GO:0070887 cellular response to chemical stimulus No
GO:0055088 lipid homeostasis No
GO:0071417 cellular response to organonitrogen compound No
GO:0043200 response to amino acid No
GO:0055092 sterol homeostasis No
GO:0071229 cellular response to acid chemical No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup2550
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g2976.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g3810.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g2909.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g315.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g3364.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g7724.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g2596.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g256.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g2123.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g4641.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g949.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g6730.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g6524.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g2368.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g4257.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g7296.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g3510.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g3112.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g2024.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g4573.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g7087.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g1010.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g8709.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g700.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g3243.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g4064.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g4879.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g2516.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g6931.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g1375.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g4031.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g1372.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g260.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g6607.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g2024.t1
MGICASCLGGNRHDSPEPESERLLDDDPYQAGYGYGALNHAHQASQPDSEYVRREREALESICQRTSDSVIDIWS
IQPQPHLRPQATLHTPISASPVPSQRTDTTTPVVSTHHTSPPSRPTSGSSGTVPKHWGEVVVNPNKKRSRTNIKT
DSKASHDVFGVLNVT*
Coding >Pro_DTO070G2_2|g2024.t1
ATGGGTATCTGTGCCTCCTGCCTCGGCGGGAATCGCCACGACTCTCCTGAGCCTGAATCTGAACGTCTACTCGAT
GATGATCCTTATCAGGCCGGGTATGGCTACGGAGCACTCAACCATGCTCATCAGGCTAGCCAGCCAGATTCGGAA
TATGTGAGGCGTGAGAGGGAGGCGCTGGAATCAATCTGCCAGCGGACATCTGACTCTGTCATCGATATCTGGTCC
ATCCAACCACAACCACACCTTCGACCCCAAGCAACTCTCCACACCCCTATCTCTGCATCTCCCGTCCCATCACAA
AGGACCGATACAACAACACCTGTGGTATCTACGCACCATACATCACCGCCAAGCCGTCCCACCTCTGGCTCGTCA
GGCACCGTCCCGAAACACTGGGGTGAAGTTGTCGTGAACCCGAACAAGAAACGATCTCGTACCAATATCAAAACG
GATTCCAAAGCCAGCCATGATGTTTTTGGGGTTCTCAACGTCACCTAA
Transcript >Pro_DTO070G2_2|g2024.t1
ATGGGTATCTGTGCCTCCTGCCTCGGCGGGAATCGCCACGACTCTCCTGAGCCTGAATCTGAACGTCTACTCGAT
GATGATCCTTATCAGGCCGGGTATGGCTACGGAGCACTCAACCATGCTCATCAGGCTAGCCAGCCAGATTCGGAA
TATGTGAGGCGTGAGAGGGAGGCGCTGGAATCAATCTGCCAGCGGACATCTGACTCTGTCATCGATATCTGGTCC
ATCCAACCACAACCACACCTTCGACCCCAAGCAACTCTCCACACCCCTATCTCTGCATCTCCCGTCCCATCACAA
AGGACCGATACAACAACACCTGTGGTATCTACGCACCATACATCACCGCCAAGCCGTCCCACCTCTGGCTCGTCA
GGCACCGTCCCGAAACACTGGGGTGAAGTTGTCGTGAACCCGAACAAGAAACGATCTCGTACCAATATCAAAACG
GATTCCAAAGCCAGCCATGATGTTTTTGGGGTTCTCAACGTCACCTAA
Gene >Pro_DTO070G2_2|g2024.t1
ATGGGTATCTGTGCCTCCTGCCTCGGCGGGAATCGCCACGACTCTCCTGAGGTGAGTCTAAATCCGAAGCTAGTC
TCTTTCCCGTTACCATGTTCATCGCGCATTACCTCGGTCTGATGCGCGATGCGTGGGGGTTCTAGTCGCAGAGTG
CAATTGTCTAACATTTCTTTCTTCAAGCCTGAATCTGAACGTCTACTCGATGATGATCCTTATCAGGCCGGGTAT
GGCTACGGAGCACTCAACCATGCTCATCAGGCTAGCCAGCCAGATTCGGAATATGTGAGGCGTGAGAGGGAGGCG
CTGGAATCAATCTGCCAGCGGACATCTGAGTGAGTATACTGTCCTAGTTGCCTTCTGTTCATATGGAGTTGAATT
CATGCTAATCGTGTCCCTTAGCTCTGTCATCGATATCTGGTCCATCCAACCACAACCACACCTTCGACCCCAAGC
AACTCTCCACACCCCTATCTCTGCATCTCCCGTCCCATCACAAAGGACCGATACAACAACACCTGTGGTATCTAC
GCACCATACATCACCGCCAAGCCGTCCCACCTCTGGCTCGTCAGGCACCGTCCCGAAACACTGGGGTGAAGTTGT
CGTGAACCCGAACAAGAAACGATCTCGTACCAATATCAAAACGGATTCCAAAGCCAGCCATGATGTTTTTGGGGT
TCTCAACGTCACCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail