Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g1671.t1
Gene name
Locationscaffold_01:4433337..4441322
Strand+
Gene length (bp)7985
Transcript length (bp)7698
Coding sequence length (bp)7698
Protein length (aa) 2566

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 8.2E-74 39 288
PF00698 Acyl_transf_1 Acyl transferase domain 2.4E-60 563 892
PF08659 KR KR domain 1.1E-49 2174 2354
PF14765 PS-DH Polyketide synthase dehydratase 3.0E-48 949 1267
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 2.2E-39 297 414
PF08242 Methyltransf_12 Methyltransferase domain 4.7E-20 1444 1549
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 1.8E-16 417 502
PF00106 adh_short short chain dehydrogenase 1.4E-15 2177 2335
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.7E-13 1975 2104
PF13649 Methyltransf_25 Methyltransferase domain 2.1E-11 1442 1548
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 1.5E-10 2012 2150
PF08241 Methyltransf_11 Methyltransferase domain 1.7E-09 1444 1551
PF13489 Methyltransf_23 Methyltransferase domain 3.6E-09 1436 1602
PF00550 PP-binding Phosphopantetheine attachment site 1.2E-06 2473 2538
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.1E-06 2183 2334
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.5E-05 1431 1562
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 2.1E-05 1858 1914

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g1671.t1
MRLQQPSGTGTPVAESANAFLHEAPSEIADNATGDVPKRMAIIGMSCRLPGDVSTAEEFWDLCSRGRSAWSLIPK
NRFNAESFYHPDPDRPGSFNPVGAHFLKEDVGLFDAPFFNITLQEARSMDPQQRIFLECVYEALENAGIPSHEIS
GQKVGVFAGASYPDYEINNTKDITAIPMYAATGTAVALQANRISYYFDLNGPSVTVDTACSSSLSALHLASQSIR
NGECSMAIVGGCHLNITPETFISMTRSRLLSDTGRSYAFDHRGTGFGRGEGAGCIILKSLEDAEAAGDAIRSVII
NSGLNQDGRTRGIAMPNGKAQEELIRQVYKEARIDPSLVGFVEAHGTGTKVGDPLEATALNAVFGKGRTPRQPLL
VGSVKSNIGHTEGTSGVVSVIKTTLALERGFVPPNCNFEKANDEIPMEDWNMKVPKKLMPWPRGKPYASVNNFGF
GGTNAHVILQRGPRHEGDLAANNDPLRRRLYVVSAYDKQAALQLGKSIGTYLDLFPVVFKDSTLDNMAYTLGQRR
TFLPWRLACSAILGQELNASLSNDAVPVRSSKEPTVGFVFTGQGAQWHGMGKELLGTYPVFKKTMQDVDACLKSF
GATFSIIDELLLTDPSASSISAAYMSQPACTAVQLALVDLLSSWGIRPKAVVGHSSGEIAAAYAAGILNFEECVR
VAYSRGVAANLVANDKSIKGGMLAVGASASDIQQILDAMRGNQAVIACVNSESSVTLSGDAEVIDDLQTALDKEG
IFTRRLQVEVAYHSHHMKIVSHEYRCLLGKIAPRDSEVSFHSTVYGKLVPGSTLGASYWVDNLVSRVEFVEGLKS
LITDEQANTPITTLVEIGPHPALQTPVKDIAQKYAPNSNVHYLHTLKRKVDDIEAVQNLAGSLFTQGLNLDFQAI
NFPNLKTTTRKPALLTNLPKYPWNHSERYWFSSRIGDNHFHPQFPRSDILGSLCMENVDFEPRWRNIIRADDHPW
IREHRVHDRTVYPMTGFLAMAMEAISQHAQLHHVTPGKIDIRDIFINRVLTIPDNSSVETILTLKPSRSEAPSKS
VLGWHEFKVFSWTEGRGWDQHCNGFIMVQEAKDVNPVDGSRQELEKTARFTQQALNMRSSCNIPVHIDFLYENIA
NGGVNYGPLFQGLTEASVSRDGQALATLRIPDTKAAMPHGHETPCILHPVTLDLCSQVMWLLRGYGEPGPHTTFV
PSHVKHISVSLSHEISAGTVLQLYGSGSGNESASNPETNRIFATVPSNPANLLIDINGITLVPISNDIKGSTDNS
PDQICYKMQYEPCFDFLSAEDYRQLPRPETDVAQGIERMQQLEYVAEYYLAQMVNSVTEDDLSTFEPHHRQFYLW
AQKTCRKAGTKDALSLDVLEQSRTVDGASELAFKVGELLPKILRGEVDALSVLLEDDGIGRYYSDLDALREAYAN
ASVCVDKMAHQNPTLNIIEIGAGTGGATMPILQSLGGEPGSTPRFGHYTYTDISPGFFEKAKTKFESWRHLMTYQ
TLDVSADPTGQGFTNGTYDVVVACNVLHATTDISQTMANIRGLLKPGGKVILIEETVPRARHFPFALLPGWWLAN
DKFRTDGPLLTVEGWSNVMKENDFSGVDLCVEEYPGASFQSGCLMTSTANIPITGPANAGDVVILGVDSIGTFSS
LSLESGLKEMIGVDPITAVNSDEVDVTGKWCIFLGGMDRSILSHLTQDKFNALQRLLSRARGLLWVVRHSKSDLE
SLGANMAIGLARTVRSETGLQFATLDLGERENMPDAEAVKHMLKVFNGVFCQKSQLAQNDWEFVVRNGNVCVPRL
VDNNTLNLSVQQETPNAPPQMQPFKQDRALRLAAGDGRGLDELYFTDDVSRNGALPEDHIEIQVHSTGLNFRDVL
MAMGQLQGERLGQECSGVVTQVGAAVSDFKIGDRVCAMSPGSLSTFTRCPASGSLLIPDDMSFETSASIPAVFCT
AFYSLIDLGRLSKDESVLIHAAAGGVGQAAIIIAQSIGANIFATVGSLEKKNFLMETYQLKEDHIFFSRDMSFVQ
GIQHATGGQGVDVALNSLSGDALQATFECVAPFGRFIELGKRDITTNSRLEMSHFNKNISFASVDLGMVREKRPQ
LTKRLLRDAFKLFVDTNAQSKWSVTTLPISDVEIGFRALQGGQVIGKIVVQVTDDSMVKVYPARRDENLLRADAS
YIIVGGTGGIGLNIASWMPERGAKNLILVSRSGIKTEKAEQAVQNLIRQGVNVEVCRCDVADQQSVEQDLVPLLA
RMPPARGVVYGAMVLRDTLFEKLSFADYQTVMMPRVHGIWNVQRALATTNGTVDFFINLSSAASFVGNMGQSPYA
ASGTFMAALAQYPETARMRCSTIDLPIVRGVGYLSDDQKREAISKQLGTESVDATDIRGLVTAAIRNEFDSSCEG
HCVAGFEAVKSTPASEQPFWVNDTKLSHLLRLSTLAGGDALAESAQSGAEISPAIVIRQSKTREGAEAIVGAAVL
NKISSILMRPMEDLDPAAPITVYGLDSLVGIEIRNWISRELEANLQILEILTSESVPALAEMILKKSGILTSDLK
VEWGLDMAEGRTSQE*
Coding >Pro_DTO070G2_2|g1671.t1
ATGCGCCTTCAACAGCCCTCCGGGACTGGAACTCCAGTTGCCGAGAGCGCGAATGCATTTTTGCACGAAGCACCT
AGTGAGATCGCCGATAATGCCACAGGCGATGTGCCCAAGCGAATGGCCATCATCGGCATGTCCTGCCGCCTCCCA
GGCGACGTTTCCACGGCCGAAGAGTTCTGGGACCTGTGTTCTCGAGGACGGAGTGCTTGGTCGCTAATCCCGAAA
AACCGATTCAACGCCGAGTCCTTCTATCACCCTGATCCAGATCGACCAGGTTCCTTCAACCCAGTAGGAGCTCAC
TTCCTGAAAGAAGACGTTGGCCTATTCGATGCGCCATTTTTCAACATTACACTCCAAGAGGCGAGATCAATGGAT
CCGCAACAGCGTATTTTCCTTGAATGTGTGTATGAAGCCCTCGAGAACGCTGGAATTCCGAGTCACGAGATCAGT
GGCCAAAAAGTGGGAGTCTTCGCAGGCGCCTCATACCCAGACTACGAAATCAACAACACCAAAGATATCACGGCT
ATCCCTATGTATGCTGCCACTGGAACAGCCGTGGCATTGCAGGCGAATCGAATTTCGTATTATTTTGACTTGAAC
GGGCCTAGTGTTACGGTCGACACAGCTTGCTCTTCCAGCTTATCTGCTCTGCATCTGGCTTCTCAGAGTATCCGG
AACGGTGAATGTTCCATGGCCATTGTGGGAGGATGTCACCTCAATATAACCCCCGAGACTTTCATCTCAATGACA
CGTTCTAGACTACTTTCCGACACTGGTCGCTCATATGCATTTGATCACCGCGGTACTGGCTTTGGCCGAGGTGAA
GGTGCTGGATGTATTATATTGAAGTCTCTTGAGGATGCGGAGGCTGCTGGAGACGCTATCCGATCTGTAATTATC
AACAGTGGTCTCAACCAGGATGGACGGACCAGAGGTATTGCAATGCCAAATGGCAAGGCACAGGAAGAACTGATT
CGCCAAGTCTATAAAGAGGCACGCATTGACCCGTCCTTGGTAGGATTTGTGGAGGCTCACGGTACGGGAACCAAA
GTTGGTGATCCCCTCGAAGCCACTGCATTGAATGCCGTTTTTGGCAAAGGACGCACTCCGCGTCAACCGTTGCTT
GTTGGGTCTGTAAAATCGAACATTGGTCATACAGAAGGAACCAGCGGCGTTGTTTCTGTGATCAAAACTACCTTG
GCACTTGAGCGAGGCTTCGTACCCCCAAACTGCAATTTTGAGAAGGCAAATGATGAGATACCGATGGAAGACTGG
AATATGAAGGTTCCCAAGAAGCTCATGCCTTGGCCCCGTGGCAAACCATACGCAAGTGTGAACAACTTCGGCTTC
GGCGGGACCAATGCCCATGTTATCCTACAGCGTGGTCCCCGGCACGAAGGTGACCTTGCAGCGAACAACGATCCT
CTCAGGCGAAGGTTGTATGTTGTCTCTGCGTACGATAAACAGGCTGCTCTTCAGCTTGGGAAATCAATCGGAACA
TACCTCGACCTTTTCCCGGTTGTTTTCAAAGATAGCACTTTGGATAATATGGCCTATACACTGGGACAGCGACGA
ACATTCCTGCCATGGAGGTTGGCATGCTCTGCAATCCTTGGACAGGAGCTGAATGCATCTCTATCTAACGACGCA
GTGCCTGTTCGTTCTTCCAAAGAGCCTACTGTCGGCTTTGTCTTCACTGGACAAGGTGCGCAATGGCACGGTATG
GGCAAAGAACTTCTGGGCACCTACCCGGTCTTCAAGAAGACTATGCAGGATGTTGACGCTTGCTTGAAATCATTC
GGTGCTACGTTCTCAATTATAGATGAATTGCTTTTGACCGACCCGAGCGCGAGCTCTATTTCTGCCGCATACATG
AGCCAGCCGGCTTGTACTGCGGTCCAGCTAGCGTTGGTTGACCTGCTCTCATCCTGGGGTATTCGCCCCAAGGCA
GTGGTCGGCCATTCTAGCGGAGAGATTGCAGCAGCTTACGCGGCTGGCATTCTGAATTTCGAAGAATGTGTTCGT
GTGGCGTACTCTCGTGGTGTCGCGGCAAACTTGGTAGCAAATGACAAGTCTATCAAGGGAGGTATGTTAGCGGTT
GGAGCCAGCGCCTCAGACATCCAGCAAATTTTGGATGCTATGCGAGGGAACCAGGCTGTCATTGCCTGTGTGAAC
AGTGAGTCCAGCGTGACTTTGTCTGGAGACGCGGAGGTCATCGACGATCTGCAGACTGCCTTGGACAAAGAAGGG
ATCTTCACCCGGAGATTGCAGGTTGAGGTTGCTTACCACTCCCATCATATGAAGATTGTCTCGCACGAATATAGA
TGCCTACTCGGTAAGATTGCACCTCGGGACTCTGAGGTTTCATTCCATTCGACTGTCTATGGAAAATTGGTCCCA
GGAAGCACCTTGGGTGCCTCCTACTGGGTGGACAATCTGGTCTCTCGTGTGGAGTTTGTGGAGGGTCTGAAGAGC
CTTATCACCGATGAGCAGGCAAATACGCCAATCACCACATTAGTCGAAATTGGCCCTCACCCTGCGCTGCAGACA
CCTGTCAAAGACATTGCGCAGAAATACGCCCCAAATTCCAACGTCCATTATCTTCATACCTTGAAACGCAAGGTA
GATGACATCGAAGCTGTCCAAAACCTAGCTGGCTCGCTGTTCACACAGGGTCTGAATCTCGACTTCCAAGCTATC
AACTTCCCGAACTTGAAGACAACGACGAGAAAGCCAGCTTTGTTGACAAATCTGCCCAAATATCCGTGGAACCAC
TCGGAAAGATACTGGTTTAGCTCACGGATAGGTGATAACCATTTCCATCCCCAATTCCCTCGGAGTGATATCCTT
GGCTCATTGTGCATGGAGAATGTCGACTTTGAACCTAGGTGGAGGAACATCATTCGTGCAGATGATCACCCTTGG
ATCCGCGAGCACAGAGTCCATGACCGCACTGTGTATCCAATGACCGGATTCTTGGCCATGGCCATGGAGGCTATT
TCACAACATGCACAGCTGCACCATGTCACTCCCGGAAAGATCGATATCCGCGATATCTTCATTAACCGTGTCCTG
ACTATCCCGGATAACTCATCGGTGGAGACAATTCTCACCTTGAAACCATCCCGATCGGAAGCCCCCAGCAAATCA
GTCCTCGGCTGGCACGAGTTCAAGGTTTTCTCATGGACCGAGGGTCGCGGATGGGACCAACACTGCAATGGTTTC
ATCATGGTGCAAGAAGCGAAGGATGTCAATCCTGTCGACGGGTCTCGACAAGAGCTCGAGAAGACAGCACGCTTC
ACTCAACAAGCATTGAATATGCGAAGTTCCTGTAATATTCCTGTGCATATCGATTTCCTCTACGAGAATATCGCC
AACGGTGGTGTGAATTACGGTCCTCTCTTCCAAGGGCTAACCGAAGCCTCTGTGAGCAGGGATGGCCAAGCACTC
GCTACCTTACGCATCCCAGACACGAAGGCAGCAATGCCACATGGGCATGAGACCCCCTGCATTCTGCATCCTGTT
ACACTTGATCTATGTAGTCAAGTCATGTGGCTGCTTCGTGGTTACGGCGAACCCGGGCCGCATACCACCTTTGTG
CCATCGCATGTGAAGCACATCTCCGTTTCATTGTCCCACGAAATAAGTGCTGGTACTGTACTCCAACTCTATGGT
AGTGGGTCAGGAAACGAGTCCGCGAGCAACCCTGAGACAAACCGCATATTCGCCACCGTTCCCAGCAACCCGGCG
AATCTGCTCATTGACATCAATGGTATTACTTTGGTTCCCATATCGAATGATATCAAAGGCTCAACGGACAATTCG
CCGGATCAGATTTGCTACAAGATGCAATATGAGCCCTGCTTTGATTTCCTCTCCGCCGAAGATTATCGACAGCTT
CCTCGCCCCGAGACTGATGTTGCCCAAGGCATTGAGCGAATGCAGCAACTCGAATATGTGGCAGAGTACTACCTT
GCACAGATGGTCAACTCTGTGACAGAAGATGATTTGTCTACCTTCGAGCCCCATCATCGGCAATTCTATCTTTGG
GCCCAGAAAACTTGCCGAAAGGCGGGCACCAAAGATGCCTTATCACTTGACGTCCTTGAACAAAGCCGAACCGTT
GATGGAGCAAGTGAGCTGGCATTCAAAGTGGGAGAGTTGCTTCCAAAAATCCTCAGGGGCGAGGTAGACGCCTTG
AGTGTACTTCTGGAGGATGATGGAATCGGAAGATACTACAGCGATCTTGACGCTCTTCGCGAGGCCTATGCCAAT
GCCTCTGTCTGTGTTGACAAGATGGCACATCAAAACCCTACACTCAACATCATTGAGATTGGTGCTGGAACAGGC
GGTGCTACCATGCCTATTTTGCAGAGTCTGGGCGGCGAACCAGGGTCAACGCCTCGGTTTGGGCACTACACTTAT
ACCGACATCTCTCCCGGCTTCTTTGAAAAAGCCAAGACAAAGTTCGAGAGCTGGAGACATCTCATGACATACCAG
ACACTAGATGTGTCGGCTGATCCCACTGGCCAAGGCTTCACCAATGGCACATATGATGTTGTAGTTGCTTGCAAT
GTGCTGCATGCTACTACCGACATCAGCCAGACGATGGCAAACATCCGAGGACTTCTGAAGCCTGGTGGCAAGGTT
ATACTCATCGAGGAAACTGTCCCCAGGGCACGCCACTTCCCATTCGCACTCCTCCCTGGATGGTGGCTGGCCAAT
GACAAATTCCGCACAGACGGACCCCTCCTCACCGTCGAAGGATGGAGCAATGTGATGAAGGAGAATGACTTCTCC
GGGGTTGACCTGTGTGTCGAGGAGTACCCTGGAGCATCTTTCCAATCTGGTTGTCTCATGACATCCACTGCTAAT
ATCCCAATAACCGGTCCCGCAAACGCCGGTGATGTTGTGATTCTTGGCGTTGACTCGATCGGCACTTTTTCGTCG
CTCAGTCTCGAATCTGGTCTCAAGGAGATGATTGGGGTTGACCCCATCACGGCTGTCAACTCTGATGAGGTTGAT
GTTACCGGAAAATGGTGTATTTTCCTTGGGGGAATGGATCGCTCGATCCTATCGCATCTCACCCAAGACAAATTC
AACGCATTGCAGCGTCTTCTGAGTCGGGCTCGGGGTCTACTGTGGGTTGTTCGTCACAGCAAATCCGATTTGGAA
TCGCTTGGTGCGAACATGGCAATTGGATTAGCTCGCACTGTGAGATCAGAGACTGGGCTCCAATTCGCCACGCTT
GACCTGGGAGAGCGGGAGAACATGCCCGACGCTGAGGCAGTGAAGCATATGCTCAAGGTATTTAACGGAGTCTTT
TGTCAGAAATCGCAGCTGGCCCAGAATGACTGGGAGTTTGTTGTCCGAAATGGCAATGTTTGTGTGCCCCGCTTG
GTTGACAATAACACATTGAACCTCAGTGTCCAGCAAGAGACACCAAATGCCCCTCCCCAGATGCAGCCTTTCAAA
CAAGATCGGGCTTTGCGACTTGCTGCCGGAGACGGGAGGGGTCTTGATGAGCTTTATTTCACAGATGATGTTTCC
CGCAACGGAGCACTGCCGGAAGACCACATTGAGATCCAGGTTCACAGCACCGGTCTCAACTTTCGAGATGTCTTG
ATGGCCATGGGCCAGCTTCAAGGTGAAAGACTCGGACAGGAATGTAGTGGAGTCGTGACTCAAGTGGGAGCCGCG
GTGTCCGACTTCAAGATCGGAGATCGAGTCTGTGCAATGTCACCAGGTTCATTGTCAACTTTCACTCGCTGTCCG
GCCTCTGGATCCTTGCTTATTCCTGACGACATGTCATTCGAGACATCAGCTTCGATTCCAGCTGTGTTTTGTACT
GCCTTCTATTCTCTCATTGACTTGGGGAGACTGAGCAAAGATGAGAGCGTCCTGATCCACGCCGCTGCAGGAGGA
GTTGGCCAAGCGGCAATAATCATTGCTCAAAGCATTGGAGCTAATATCTTCGCAACCGTTGGCAGCCTCGAAAAG
AAAAACTTCCTTATGGAAACTTACCAGCTGAAAGAGGATCATATCTTCTTCAGTCGTGACATGTCATTTGTGCAG
GGTATTCAGCACGCCACTGGTGGTCAGGGTGTGGATGTTGCCCTCAACTCGCTTAGCGGTGATGCTTTGCAAGCA
ACATTCGAGTGTGTCGCGCCATTTGGTCGTTTCATTGAACTGGGCAAGCGGGACATCACGACAAACTCTCGGTTG
GAGATGTCTCACTTTAACAAGAACATCTCCTTCGCATCTGTCGATTTGGGAATGGTCAGAGAGAAGCGTCCGCAA
TTGACGAAGCGGCTGCTTCGTGATGCGTTTAAGCTGTTTGTTGACACTAACGCCCAATCAAAGTGGTCTGTCACC
ACTCTTCCTATCTCAGACGTCGAGATTGGATTCCGTGCGCTGCAGGGTGGACAGGTGATCGGCAAGATAGTCGTC
CAGGTCACGGATGATTCCATGGTTAAGGTCTATCCCGCCAGAAGAGACGAAAACCTCCTCCGCGCGGACGCTTCA
TATATCATCGTTGGTGGGACCGGTGGGATTGGCCTCAACATTGCCAGCTGGATGCCAGAGAGGGGAGCCAAGAAT
CTTATCCTGGTTTCTCGAAGTGGTATTAAGACTGAAAAGGCCGAGCAAGCTGTTCAGAATCTTATCCGCCAGGGT
GTTAATGTGGAAGTCTGTCGCTGCGATGTGGCGGACCAACAGAGCGTGGAGCAAGATCTTGTTCCGCTCCTCGCT
CGCATGCCTCCCGCTCGTGGTGTTGTATACGGCGCCATGGTTCTCCGGGATACGCTCTTCGAAAAGCTCAGTTTT
GCGGACTACCAAACGGTGATGATGCCCAGAGTCCACGGAATCTGGAACGTTCAACGGGCATTGGCAACAACTAAT
GGTACCGTGGATTTCTTCATCAACCTATCGTCCGCCGCTAGTTTTGTAGGCAATATGGGTCAATCACCATACGCA
GCCAGTGGAACCTTCATGGCTGCGCTCGCCCAGTACCCTGAGACAGCCAGGATGCGCTGTTCAACAATCGATTTG
CCCATTGTGCGTGGAGTCGGATATCTCTCCGACGATCAGAAGCGCGAGGCAATCTCCAAACAATTGGGCACAGAG
TCCGTTGATGCAACTGATATCCGTGGTCTTGTAACGGCAGCAATCCGCAACGAGTTCGACAGTTCATGCGAGGGT
CACTGCGTGGCTGGGTTTGAAGCAGTCAAATCCACACCTGCCAGTGAACAGCCCTTCTGGGTAAACGATACCAAG
CTGTCGCACCTGTTGCGCCTCTCTACTCTCGCTGGCGGGGATGCATTGGCCGAGTCTGCACAGAGCGGTGCCGAG
ATTTCACCAGCAATTGTTATCCGGCAATCGAAGACCCGCGAAGGAGCCGAGGCCATTGTTGGGGCTGCCGTGCTC
AACAAGATCTCTAGCATTCTTATGCGTCCGATGGAAGACCTTGACCCTGCTGCGCCTATCACGGTTTACGGCTTG
GACTCGCTGGTCGGTATCGAGATCCGAAACTGGATCTCCCGCGAGTTGGAAGCTAATTTGCAGATCCTTGAGATT
TTGACCAGTGAATCTGTCCCGGCTCTTGCCGAGATGATTCTCAAGAAATCGGGTATACTTACTTCAGACCTCAAG
GTTGAGTGGGGTCTTGACATGGCTGAAGGCAGAACCAGCCAAGAATGA
Transcript >Pro_DTO070G2_2|g1671.t1
ATGCGCCTTCAACAGCCCTCCGGGACTGGAACTCCAGTTGCCGAGAGCGCGAATGCATTTTTGCACGAAGCACCT
AGTGAGATCGCCGATAATGCCACAGGCGATGTGCCCAAGCGAATGGCCATCATCGGCATGTCCTGCCGCCTCCCA
GGCGACGTTTCCACGGCCGAAGAGTTCTGGGACCTGTGTTCTCGAGGACGGAGTGCTTGGTCGCTAATCCCGAAA
AACCGATTCAACGCCGAGTCCTTCTATCACCCTGATCCAGATCGACCAGGTTCCTTCAACCCAGTAGGAGCTCAC
TTCCTGAAAGAAGACGTTGGCCTATTCGATGCGCCATTTTTCAACATTACACTCCAAGAGGCGAGATCAATGGAT
CCGCAACAGCGTATTTTCCTTGAATGTGTGTATGAAGCCCTCGAGAACGCTGGAATTCCGAGTCACGAGATCAGT
GGCCAAAAAGTGGGAGTCTTCGCAGGCGCCTCATACCCAGACTACGAAATCAACAACACCAAAGATATCACGGCT
ATCCCTATGTATGCTGCCACTGGAACAGCCGTGGCATTGCAGGCGAATCGAATTTCGTATTATTTTGACTTGAAC
GGGCCTAGTGTTACGGTCGACACAGCTTGCTCTTCCAGCTTATCTGCTCTGCATCTGGCTTCTCAGAGTATCCGG
AACGGTGAATGTTCCATGGCCATTGTGGGAGGATGTCACCTCAATATAACCCCCGAGACTTTCATCTCAATGACA
CGTTCTAGACTACTTTCCGACACTGGTCGCTCATATGCATTTGATCACCGCGGTACTGGCTTTGGCCGAGGTGAA
GGTGCTGGATGTATTATATTGAAGTCTCTTGAGGATGCGGAGGCTGCTGGAGACGCTATCCGATCTGTAATTATC
AACAGTGGTCTCAACCAGGATGGACGGACCAGAGGTATTGCAATGCCAAATGGCAAGGCACAGGAAGAACTGATT
CGCCAAGTCTATAAAGAGGCACGCATTGACCCGTCCTTGGTAGGATTTGTGGAGGCTCACGGTACGGGAACCAAA
GTTGGTGATCCCCTCGAAGCCACTGCATTGAATGCCGTTTTTGGCAAAGGACGCACTCCGCGTCAACCGTTGCTT
GTTGGGTCTGTAAAATCGAACATTGGTCATACAGAAGGAACCAGCGGCGTTGTTTCTGTGATCAAAACTACCTTG
GCACTTGAGCGAGGCTTCGTACCCCCAAACTGCAATTTTGAGAAGGCAAATGATGAGATACCGATGGAAGACTGG
AATATGAAGGTTCCCAAGAAGCTCATGCCTTGGCCCCGTGGCAAACCATACGCAAGTGTGAACAACTTCGGCTTC
GGCGGGACCAATGCCCATGTTATCCTACAGCGTGGTCCCCGGCACGAAGGTGACCTTGCAGCGAACAACGATCCT
CTCAGGCGAAGGTTGTATGTTGTCTCTGCGTACGATAAACAGGCTGCTCTTCAGCTTGGGAAATCAATCGGAACA
TACCTCGACCTTTTCCCGGTTGTTTTCAAAGATAGCACTTTGGATAATATGGCCTATACACTGGGACAGCGACGA
ACATTCCTGCCATGGAGGTTGGCATGCTCTGCAATCCTTGGACAGGAGCTGAATGCATCTCTATCTAACGACGCA
GTGCCTGTTCGTTCTTCCAAAGAGCCTACTGTCGGCTTTGTCTTCACTGGACAAGGTGCGCAATGGCACGGTATG
GGCAAAGAACTTCTGGGCACCTACCCGGTCTTCAAGAAGACTATGCAGGATGTTGACGCTTGCTTGAAATCATTC
GGTGCTACGTTCTCAATTATAGATGAATTGCTTTTGACCGACCCGAGCGCGAGCTCTATTTCTGCCGCATACATG
AGCCAGCCGGCTTGTACTGCGGTCCAGCTAGCGTTGGTTGACCTGCTCTCATCCTGGGGTATTCGCCCCAAGGCA
GTGGTCGGCCATTCTAGCGGAGAGATTGCAGCAGCTTACGCGGCTGGCATTCTGAATTTCGAAGAATGTGTTCGT
GTGGCGTACTCTCGTGGTGTCGCGGCAAACTTGGTAGCAAATGACAAGTCTATCAAGGGAGGTATGTTAGCGGTT
GGAGCCAGCGCCTCAGACATCCAGCAAATTTTGGATGCTATGCGAGGGAACCAGGCTGTCATTGCCTGTGTGAAC
AGTGAGTCCAGCGTGACTTTGTCTGGAGACGCGGAGGTCATCGACGATCTGCAGACTGCCTTGGACAAAGAAGGG
ATCTTCACCCGGAGATTGCAGGTTGAGGTTGCTTACCACTCCCATCATATGAAGATTGTCTCGCACGAATATAGA
TGCCTACTCGGTAAGATTGCACCTCGGGACTCTGAGGTTTCATTCCATTCGACTGTCTATGGAAAATTGGTCCCA
GGAAGCACCTTGGGTGCCTCCTACTGGGTGGACAATCTGGTCTCTCGTGTGGAGTTTGTGGAGGGTCTGAAGAGC
CTTATCACCGATGAGCAGGCAAATACGCCAATCACCACATTAGTCGAAATTGGCCCTCACCCTGCGCTGCAGACA
CCTGTCAAAGACATTGCGCAGAAATACGCCCCAAATTCCAACGTCCATTATCTTCATACCTTGAAACGCAAGGTA
GATGACATCGAAGCTGTCCAAAACCTAGCTGGCTCGCTGTTCACACAGGGTCTGAATCTCGACTTCCAAGCTATC
AACTTCCCGAACTTGAAGACAACGACGAGAAAGCCAGCTTTGTTGACAAATCTGCCCAAATATCCGTGGAACCAC
TCGGAAAGATACTGGTTTAGCTCACGGATAGGTGATAACCATTTCCATCCCCAATTCCCTCGGAGTGATATCCTT
GGCTCATTGTGCATGGAGAATGTCGACTTTGAACCTAGGTGGAGGAACATCATTCGTGCAGATGATCACCCTTGG
ATCCGCGAGCACAGAGTCCATGACCGCACTGTGTATCCAATGACCGGATTCTTGGCCATGGCCATGGAGGCTATT
TCACAACATGCACAGCTGCACCATGTCACTCCCGGAAAGATCGATATCCGCGATATCTTCATTAACCGTGTCCTG
ACTATCCCGGATAACTCATCGGTGGAGACAATTCTCACCTTGAAACCATCCCGATCGGAAGCCCCCAGCAAATCA
GTCCTCGGCTGGCACGAGTTCAAGGTTTTCTCATGGACCGAGGGTCGCGGATGGGACCAACACTGCAATGGTTTC
ATCATGGTGCAAGAAGCGAAGGATGTCAATCCTGTCGACGGGTCTCGACAAGAGCTCGAGAAGACAGCACGCTTC
ACTCAACAAGCATTGAATATGCGAAGTTCCTGTAATATTCCTGTGCATATCGATTTCCTCTACGAGAATATCGCC
AACGGTGGTGTGAATTACGGTCCTCTCTTCCAAGGGCTAACCGAAGCCTCTGTGAGCAGGGATGGCCAAGCACTC
GCTACCTTACGCATCCCAGACACGAAGGCAGCAATGCCACATGGGCATGAGACCCCCTGCATTCTGCATCCTGTT
ACACTTGATCTATGTAGTCAAGTCATGTGGCTGCTTCGTGGTTACGGCGAACCCGGGCCGCATACCACCTTTGTG
CCATCGCATGTGAAGCACATCTCCGTTTCATTGTCCCACGAAATAAGTGCTGGTACTGTACTCCAACTCTATGGT
AGTGGGTCAGGAAACGAGTCCGCGAGCAACCCTGAGACAAACCGCATATTCGCCACCGTTCCCAGCAACCCGGCG
AATCTGCTCATTGACATCAATGGTATTACTTTGGTTCCCATATCGAATGATATCAAAGGCTCAACGGACAATTCG
CCGGATCAGATTTGCTACAAGATGCAATATGAGCCCTGCTTTGATTTCCTCTCCGCCGAAGATTATCGACAGCTT
CCTCGCCCCGAGACTGATGTTGCCCAAGGCATTGAGCGAATGCAGCAACTCGAATATGTGGCAGAGTACTACCTT
GCACAGATGGTCAACTCTGTGACAGAAGATGATTTGTCTACCTTCGAGCCCCATCATCGGCAATTCTATCTTTGG
GCCCAGAAAACTTGCCGAAAGGCGGGCACCAAAGATGCCTTATCACTTGACGTCCTTGAACAAAGCCGAACCGTT
GATGGAGCAAGTGAGCTGGCATTCAAAGTGGGAGAGTTGCTTCCAAAAATCCTCAGGGGCGAGGTAGACGCCTTG
AGTGTACTTCTGGAGGATGATGGAATCGGAAGATACTACAGCGATCTTGACGCTCTTCGCGAGGCCTATGCCAAT
GCCTCTGTCTGTGTTGACAAGATGGCACATCAAAACCCTACACTCAACATCATTGAGATTGGTGCTGGAACAGGC
GGTGCTACCATGCCTATTTTGCAGAGTCTGGGCGGCGAACCAGGGTCAACGCCTCGGTTTGGGCACTACACTTAT
ACCGACATCTCTCCCGGCTTCTTTGAAAAAGCCAAGACAAAGTTCGAGAGCTGGAGACATCTCATGACATACCAG
ACACTAGATGTGTCGGCTGATCCCACTGGCCAAGGCTTCACCAATGGCACATATGATGTTGTAGTTGCTTGCAAT
GTGCTGCATGCTACTACCGACATCAGCCAGACGATGGCAAACATCCGAGGACTTCTGAAGCCTGGTGGCAAGGTT
ATACTCATCGAGGAAACTGTCCCCAGGGCACGCCACTTCCCATTCGCACTCCTCCCTGGATGGTGGCTGGCCAAT
GACAAATTCCGCACAGACGGACCCCTCCTCACCGTCGAAGGATGGAGCAATGTGATGAAGGAGAATGACTTCTCC
GGGGTTGACCTGTGTGTCGAGGAGTACCCTGGAGCATCTTTCCAATCTGGTTGTCTCATGACATCCACTGCTAAT
ATCCCAATAACCGGTCCCGCAAACGCCGGTGATGTTGTGATTCTTGGCGTTGACTCGATCGGCACTTTTTCGTCG
CTCAGTCTCGAATCTGGTCTCAAGGAGATGATTGGGGTTGACCCCATCACGGCTGTCAACTCTGATGAGGTTGAT
GTTACCGGAAAATGGTGTATTTTCCTTGGGGGAATGGATCGCTCGATCCTATCGCATCTCACCCAAGACAAATTC
AACGCATTGCAGCGTCTTCTGAGTCGGGCTCGGGGTCTACTGTGGGTTGTTCGTCACAGCAAATCCGATTTGGAA
TCGCTTGGTGCGAACATGGCAATTGGATTAGCTCGCACTGTGAGATCAGAGACTGGGCTCCAATTCGCCACGCTT
GACCTGGGAGAGCGGGAGAACATGCCCGACGCTGAGGCAGTGAAGCATATGCTCAAGGTATTTAACGGAGTCTTT
TGTCAGAAATCGCAGCTGGCCCAGAATGACTGGGAGTTTGTTGTCCGAAATGGCAATGTTTGTGTGCCCCGCTTG
GTTGACAATAACACATTGAACCTCAGTGTCCAGCAAGAGACACCAAATGCCCCTCCCCAGATGCAGCCTTTCAAA
CAAGATCGGGCTTTGCGACTTGCTGCCGGAGACGGGAGGGGTCTTGATGAGCTTTATTTCACAGATGATGTTTCC
CGCAACGGAGCACTGCCGGAAGACCACATTGAGATCCAGGTTCACAGCACCGGTCTCAACTTTCGAGATGTCTTG
ATGGCCATGGGCCAGCTTCAAGGTGAAAGACTCGGACAGGAATGTAGTGGAGTCGTGACTCAAGTGGGAGCCGCG
GTGTCCGACTTCAAGATCGGAGATCGAGTCTGTGCAATGTCACCAGGTTCATTGTCAACTTTCACTCGCTGTCCG
GCCTCTGGATCCTTGCTTATTCCTGACGACATGTCATTCGAGACATCAGCTTCGATTCCAGCTGTGTTTTGTACT
GCCTTCTATTCTCTCATTGACTTGGGGAGACTGAGCAAAGATGAGAGCGTCCTGATCCACGCCGCTGCAGGAGGA
GTTGGCCAAGCGGCAATAATCATTGCTCAAAGCATTGGAGCTAATATCTTCGCAACCGTTGGCAGCCTCGAAAAG
AAAAACTTCCTTATGGAAACTTACCAGCTGAAAGAGGATCATATCTTCTTCAGTCGTGACATGTCATTTGTGCAG
GGTATTCAGCACGCCACTGGTGGTCAGGGTGTGGATGTTGCCCTCAACTCGCTTAGCGGTGATGCTTTGCAAGCA
ACATTCGAGTGTGTCGCGCCATTTGGTCGTTTCATTGAACTGGGCAAGCGGGACATCACGACAAACTCTCGGTTG
GAGATGTCTCACTTTAACAAGAACATCTCCTTCGCATCTGTCGATTTGGGAATGGTCAGAGAGAAGCGTCCGCAA
TTGACGAAGCGGCTGCTTCGTGATGCGTTTAAGCTGTTTGTTGACACTAACGCCCAATCAAAGTGGTCTGTCACC
ACTCTTCCTATCTCAGACGTCGAGATTGGATTCCGTGCGCTGCAGGGTGGACAGGTGATCGGCAAGATAGTCGTC
CAGGTCACGGATGATTCCATGGTTAAGGTCTATCCCGCCAGAAGAGACGAAAACCTCCTCCGCGCGGACGCTTCA
TATATCATCGTTGGTGGGACCGGTGGGATTGGCCTCAACATTGCCAGCTGGATGCCAGAGAGGGGAGCCAAGAAT
CTTATCCTGGTTTCTCGAAGTGGTATTAAGACTGAAAAGGCCGAGCAAGCTGTTCAGAATCTTATCCGCCAGGGT
GTTAATGTGGAAGTCTGTCGCTGCGATGTGGCGGACCAACAGAGCGTGGAGCAAGATCTTGTTCCGCTCCTCGCT
CGCATGCCTCCCGCTCGTGGTGTTGTATACGGCGCCATGGTTCTCCGGGATACGCTCTTCGAAAAGCTCAGTTTT
GCGGACTACCAAACGGTGATGATGCCCAGAGTCCACGGAATCTGGAACGTTCAACGGGCATTGGCAACAACTAAT
GGTACCGTGGATTTCTTCATCAACCTATCGTCCGCCGCTAGTTTTGTAGGCAATATGGGTCAATCACCATACGCA
GCCAGTGGAACCTTCATGGCTGCGCTCGCCCAGTACCCTGAGACAGCCAGGATGCGCTGTTCAACAATCGATTTG
CCCATTGTGCGTGGAGTCGGATATCTCTCCGACGATCAGAAGCGCGAGGCAATCTCCAAACAATTGGGCACAGAG
TCCGTTGATGCAACTGATATCCGTGGTCTTGTAACGGCAGCAATCCGCAACGAGTTCGACAGTTCATGCGAGGGT
CACTGCGTGGCTGGGTTTGAAGCAGTCAAATCCACACCTGCCAGTGAACAGCCCTTCTGGGTAAACGATACCAAG
CTGTCGCACCTGTTGCGCCTCTCTACTCTCGCTGGCGGGGATGCATTGGCCGAGTCTGCACAGAGCGGTGCCGAG
ATTTCACCAGCAATTGTTATCCGGCAATCGAAGACCCGCGAAGGAGCCGAGGCCATTGTTGGGGCTGCCGTGCTC
AACAAGATCTCTAGCATTCTTATGCGTCCGATGGAAGACCTTGACCCTGCTGCGCCTATCACGGTTTACGGCTTG
GACTCGCTGGTCGGTATCGAGATCCGAAACTGGATCTCCCGCGAGTTGGAAGCTAATTTGCAGATCCTTGAGATT
TTGACCAGTGAATCTGTCCCGGCTCTTGCCGAGATGATTCTCAAGAAATCGGGTATACTTACTTCAGACCTCAAG
GTTGAGTGGGGTCTTGACATGGCTGAAGGCAGAACCAGCCAAGAATGA
Gene >Pro_DTO070G2_2|g1671.t1
ATGCGCCTTCAACAGCCCTCCGGGACTGGAACTCCAGTTGCCGAGAGCGCGAATGCATTTTTGCACGAAGCACCT
AGTGAGATCGCCGATAATGCCACAGGCGATGTGCCCAAGCGAATGGCCATCATCGGCATGTCCTGCCGCCTCCCA
GGCGACGTTTCCACGGCCGAAGAGTTCTGGGACCTGTGTTCTCGAGGACGGAGTGCTTGGTCGCTAATCCCGAAA
AACCGATTCAACGCCGAGTCCTTCTATCACCCTGATCCAGATCGACCAGGTTCCTTCAACCCAGTAGGAGCTCAC
TTCCTGAAAGAAGACGTTGGCCTATTCGATGCGCCATTTTTCAACATTACACTCCAAGAGGCGAGATCAATGGAT
CCGCAACAGCGTATTTTCCTTGAATGTGTGTATGAAGCCCTCGAGAACGCTGGAATTCCGAGTCACGAGATCAGT
GGCCAAAAAGTGGGAGTCTTCGCAGGCGCCTCATACCCAGACTACGAAATCAACAACACCAAAGATATCACGGCT
ATCCCTATGTATGCTGCCACTGGAACAGCCGTGGCATTGCAGGCGAATCGAATTTCGTATTATTTTGACTTGAAC
GGGCCTAGTGTTACGGTCGACACAGCTTGCTCTTCCAGCTTATCTGCTCTGCATCTGGCTTCTCAGAGTATCCGG
AACGGTGAATGTTCCATGGCCATTGTGGGAGGATGTCACCTCAATATAACCCCCGAGACTTTCATCTCAATGACA
CGTTCTAGGTAAGTGTCACTGGCAGTCTCCTTGACCCACAAAAGCTGATTAATCCCCAAGACTACTTTCCGACAC
TGGTCGCTCATATGCATTTGATCACCGCGGTACTGGCTTTGGCCGAGGTGAAGGTGCTGGATGTATTATATTGAA
GTCTCTTGAGGATGCGGAGGCTGCTGGAGACGCTATCCGATCTGTAATTATCAACAGTGGTCTCAACCAGGATGG
ACGGACCAGAGGTATTGCAATGCCAAATGGCAAGGCACAGGAAGAACTGATTCGCCAAGTCTATAAAGAGGCACG
CATTGACCCGTCCTTGGTAGGATTTGTGGAGGCTCACGGTACGGGAACCAAAGTTGGTGATCCCCTCGAAGCCAC
TGCATTGAATGCCGTTTTTGGCAAAGGACGCACTCCGCGTCAACCGTTGCTTGTTGGGTCTGTAAAATCGAACAT
TGGTCATACAGAAGGAACCAGCGGCGTTGTTTCTGTGATCAAAACTACCTTGGCACTTGAGCGAGGCTTCGTACC
CCCAAACTGCAATTTTGAGAAGGCAAATGATGAGATACCGATGGAAGACTGGAATATGAAGGTAAGATCAAGCAC
CGACTTGAGGTATCAATGGACCGAGCTAAACATCCAACCAGGTTCCCAAGAAGCTCATGCCTTGGCCCCGTGGCA
AACCATACGCAAGTGTGAACAACTTCGGCTTCGGCGGGACCAATGCCCATGTTATCCTACAGCGTGGTCCCCGGC
ACGAAGGTGACCTTGCAGCGAACAACGATCCTCTCAGGCGAAGGTTGTATGTTGTCTCTGCGTACGATAAACAGG
CTGCTCTTCAGCTTGGGAAATCAATCGGAACATACCTCGACCTTTTCCCGGTTGTTTTCAAAGATAGCACTTTGG
ATAATATGGCCTATACACTGGGACAGCGACGAACATTCCTGCCATGGAGGTTGGCATGCTCTGCAATCCTTGGAC
AGGAGCTGAATGCATCTCTATCTAACGACGCAGTGCCTGTTCGTTCTTCCAAAGAGCCTACTGTCGGCTTTGTCT
TCACTGGACAAGGTGCGCAATGGCACGGTATGGGCAAAGAACTTCTGGGCACCTACCCGGTCTTCAAGAAGACTA
TGCAGGATGTTGACGCTTGCTTGAAATCATTCGGTGCTACGTTCTCAATTATAGGTATGTCTCCAACCCAATTGT
GACACTGCCCAAAGCGATATACTCAGACACTAACCTCGCAATGCAAAGATGAATTGCTTTTGACCGACCCGAGCG
CGAGCTCTATTTCTGCCGCATACATGAGCCAGCCGGCTTGTACTGCGGTCCAGCTAGCGTTGGTTGACCTGCTCT
CATCCTGGGGTATTCGCCCCAAGGCAGTGGTCGGCCATTCTAGCGGAGAGATTGCAGCAGCTTACGCGGCTGGCA
TTCTGAATTTCGAAGAATGTGTTCGTGTGGCGTACTCTCGTGGTGTCGCGGCAAACTTGGTAGCAAATGACAAGT
CTATCAAGGGAGGTATGTTAGCGGTTGGAGCCAGCGCCTCAGACATCCAGCAAATTTTGGATGCTATGCGAGGGA
ACCAGGCTGTCATTGCCTGTGTGAACAGTGAGTCCAGCGTGACTTTGTCTGGAGACGCGGAGGTCATCGACGATC
TGCAGACTGCCTTGGACAAAGAAGGGATCTTCACCCGGAGATTGCAGGTTGAGGTTGCTTACCACTCCCATCATA
TGAAGATTGTCTCGCACGAATATAGATGCCTACTCGGTAAGATTGCACCTCGGGACTCTGAGGTTTCATTCCATT
CGACTGTCTATGGAAAATTGGTCCCAGGAAGCACCTTGGGTGCCTCCTACTGGGTGGACAATCTGGTCTCTCGTG
TGGAGTTTGTGGAGGGTCTGAAGAGCCTTATCACCGATGAGCAGGCAAATACGCCAATCACCACATTAGTCGAAA
TTGGCCCTCACCCTGCGCTGCAGACACCTGTCAAAGACATTGCGCAGAAATACGCCCCAAATTCCAACGTCCATT
ATCTTCATACCTTGAAACGCAAGGTAGATGACATCGAAGCTGTCCAAAACCTAGCTGGCTCGCTGTTCACACAGG
GTCTGAATCTCGACTTCCAAGCTATCAACTTCCCGAACTTGAAGACAACGACGAGAAAGCCAGCTTTGTTGACAA
ATCTGCCCAAATATCCGTGGAACCACTCGGAAAGATACTGGTTTAGCTCACGGATAGGTGATAACCATTTCCATC
CCCAATTCCCTCGGAGTGATATCCTTGGCTCATTGTGCATGGAGAATGTCGACTTTGAACCTAGGTGGAGGAACA
TCATTCGTGCAGATGATCACCCTTGGATCCGCGAGCACAGAGTCCATGACCGCACTGTGTATCCAATGACCGGAT
TCTTGGCCATGGCCATGGAGGCTATTTCACAACATGCACAGCTGCACCATGTCACTCCCGGAAAGATCGATATCC
GCGATATCTTCATTAACCGTGTCCTGACTATCCCGGATAACTCATCGGTGGAGACAATTCTCACCTTGAAACCAT
CCCGATCGGAAGCCCCCAGCAAATCAGTCCTCGGCTGGCACGAGTTCAAGGTTTTCTCATGGACCGAGGGTCGCG
GATGGGACCAACACTGCAATGGTTTCATCATGGTGCAAGAAGCGAAGGATGTCAATCCTGTCGACGGGTCTCGAC
AAGAGCTCGAGAAGACAGCACGCTTCACTCAACAAGCATTGAATATGCGAAGTTCCTGTAATATTCCTGTGCATA
TCGATTTCCTCTACGAGAATATCGCCAACGGTGGTGTGAATTACGGTCCTCTCTTCCAAGGGCTAACCGAAGCCT
CTGTGAGCAGGGATGGCCAAGCACTCGCTACCTTACGCATCCCAGACACGAAGGCAGCAATGCCACATGGGCATG
AGACCCCCTGCATTCTGCATCCTGTTACACTTGATCTATGTAGTCAAGTCATGTGGCTGCTTCGTGGTTACGGCG
AACCCGGGCCGCATACCACCTTTGTGCCATCGCATGTGAAGCACATCTCCGTTTCATTGTCCCACGAAATAAGTG
CTGGTACTGTACTCCAACTCTATGGTAGTGGGTCAGGAAACGAGTCCGCGAGCAACCCTGAGACAAACCGCATAT
TCGCCACCGTTCCCAGCAACCCGGCGAATCTGCTCATTGACATCAATGGTATTACTTTGGTTCCCATATCGAATG
ATATCAAAGGCTCAACGGACAATTCGCCGGATCAGATTTGCTACAAGATGCAATATGAGCCCTGCTTTGATTTCC
TCTCCGCCGAAGATTATCGACAGCTTCCTCGCCCCGAGACTGATGTTGCCCAAGGCATTGAGCGAATGCAGCAAC
TCGAATATGTGGCAGAGTACTACCTTGCACAGATGGTCAACTCTGTGACAGAAGATGATTTGTCTACCTTCGAGC
CCCATCATCGGCAATTCTATCTTTGGGCCCAGAAAACTTGCCGAAAGGCGGGCACCAAAGATGCCTTATCACTTG
ACGTCCTTGAACAAAGCCGAACCGTTGATGGAGCAAGTGAGCTGGCATTCAAAGTGGGAGAGTTGCTTCCAAAAA
TCCTCAGGGGCGAGGTAGACGCCTTGAGTGTACTTCTGGAGGATGATGGAATCGGAAGATACTACAGCGATCTTG
ACGCTCTTCGCGAGGCCTATGCCAATGCCTCTGTCTGTGTTGACAAGATGGCACATCAAAACCCTACACTCAACA
TCATTGAGATTGGTGCTGGAACAGGCGGTGCTACCATGCCTATTTTGCAGAGTCTGGGCGGCGAACCAGGGTCAA
CGCCTCGGTTTGGGCACTACACTTATACCGACATCTCTCCCGGCTTCTTTGAAAAAGCCAAGACAAAGTTCGAGA
GCTGGAGACATCTCATGACATACCAGACACTAGATGTGTCGGCTGATCCCACTGGCCAAGGCTTCACCAATGGCA
CATATGATGTTGTAGTTGCTTGCAATGTGCTGCATGCTACTACCGACATCAGCCAGACGATGGCAAACATCCGAG
GACTTCTGAAGCCTGGTGGCAAGGTTATACTCATCGAGGAAACTGTCCCCAGGGCACGCCACTTCCCATTCGCAC
TCCTCCCTGGATGGTGGCTGGCCAATGACAAATTCCGCACAGACGGACCCCTCCTCACCGTCGAAGGATGGAGCA
ATGTGATGAAGGAGAATGACTTCTCCGGGGTTGACCTGTGTGTCGAGGAGTACCCTGGAGCATCTTTCCAATCTG
GTTGTCTCATGACATCCACTGCTAATATCCCAATAACCGGTCCCGCAAACGCCGGTGATGTTGTGATTCTTGGCG
TTGACTCGATCGGCACTTTTTCGTCGCTCAGTCTCGAATCTGGTCTCAAGGAGATGATTGGGGTTGACCCCATCA
CGGCTGTCAACTCTGATGAGGTTGATGTTACCGGAAAATGGTGTATTTTCCTTGGGGGAATGGATCGCTCGATCC
TATCGCATCTCACCCAAGACAAATTCAACGCATTGCAGCGTCTTCTGAGTCGGGCTCGGGGTCTACTGTGGGTTG
TTCGTCACAGCAAATCCGATTTGGAATCGCTTGGTGCGAACATGGCAATTGGATTAGCTCGCACTGTGAGATCAG
AGACTGGGCTCCAATTCGCCACGCTTGACCTGGGAGAGCGGGAGAACATGCCCGACGCTGAGGCAGTGAAGCATA
TGCTCAAGGTATTTAACGGAGTCTTTTGTCAGAAATCGCAGCTGGCCCAGAATGACTGGGAGTTTGTTGTCCGAA
ATGGCAATGTTTGTGTGCCCCGCTTGGTTGACAATAACACATTGAACCTCAGTGTCCAGCAAGAGACACCAAATG
CCCCTCCCCAGATGCAGCCTTTCAAACAAGATCGGGCTTTGCGACTTGCTGCCGGAGACGGGAGGGGTCTTGATG
AGCTTTATTTCACAGATGATGTTTCCCGCAACGGAGCACTGCCGGAAGACCACATTGAGATCCAGGTTCACAGCA
CCGGTCTCAACTTTCGAGATGTCTTGATGGCCATGGGCCAGCTTCAAGGTGAAAGACTCGGACAGGAATGTAGTG
GAGTCGTGACTCAAGTGGGAGCCGCGGTGTCCGACTTCAAGATCGGAGATCGAGTCTGTGCAATGTCACCAGGTT
CATTGTCAACTTTCACTCGCTGTCCGGCCTCTGGATCCTTGCTTATTCCTGACGACATGTCATTCGAGACATCAG
CTTCGATTCCAGCTGTGTTTTGTACTGCCTTCTATTCTCTCATTGACTTGGGGAGACTGAGCAAAGATGAGAGCG
TCCTGATCCACGCCGCTGCAGGAGGAGTTGGCCAAGCGGCAATAATCATTGCTCAAAGCATTGGAGCTAATATCT
TCGCAACCGTTGGCAGCCTCGAAAAGAAAAACTTCCTTATGGAAACTTACCAGCTGAAAGAGGATCATATCTTCT
TCAGTCGTGACATGTCATTTGTGCAGGGTATTCAGCACGCCACTGGTGGTCAGGGTGTGGATGTTGCCCTCAACT
CGCTTAGCGGTGATGCTTTGCAAGCAACATTCGAGTGTGTCGCGCCATTTGGTCGTTTCATTGAACTGGGCAAGC
GGGACATCACGACAAACTCTCGGTTGGAGATGTCTCACTTTAACAAGAACATCTCCTTCGCATCTGTCGATTTGG
GAATGGTCAGAGAGAAGCGTCCGCAATTGACGAAGCGGCTGCTTCGTGATGCGTTTAAGCTGTTTGTTGACACTA
ACGCCCAATCAAAGTGGTCTGTCACCACTCTTCCTATCTCAGACGTCGAGATTGGATTCCGTGCGCTGCAGGGTG
GACAGGTGATCGGCAAGATAGTCGTCCAGGTCACGGATGATTCCATGGTTAAGGTATGTTTGCTGATATCTACGA
CAATTGGAGCAAATGATCGCTAACTCACCACACAGGTCTATCCCGCCAGAAGAGACGAAAACCTCCTCCGCGCGG
ACGCTTCATATATCATCGTTGGTGGGACCGGTGGGATTGGCCTCAACATTGCCAGCTGGATGCCAGAGAGGGGAG
CCAAGAATCTTATCCTGGTTTCTCGAAGTGGTATTAAGACTGAAAAGGCCGAGCAAGCTGTTCAGAATCTTATCC
GCCAGGGTGTTAATGTGGAAGTCTGTCGCTGCGATGTGGCGGACCAACAGAGCGTGGAGCAAGATCTTGTTCCGC
TCCTCGCTCGCATGCCTCCCGCTCGTGGTGTTGTATACGGCGCCATGGTTCTCCGGGTAAGTTTATCAGCATCAA
ACAACAGATAAGATCTCGGCTAACTTTCTCGTAAGGATACGCTCTTCGAAAAGCTCAGTTTTGCGGACTACCAAA
CGGTGATGATGCCCAGAGTCCACGGAATCTGGAACGTTCAACGGGCATTGGCAACAACTAATGGTACCGTGGATT
TCTTCATCAACCTATCGTCCGCCGCTAGTTTTGTAGGCAATATGGGTCAATCACCATACGCAGCCAGTGGAACCT
TCATGGCTGCGCTCGCCCAGTACCCTGAGACAGCCAGGATGCGCTGTTCAACAATCGATTTGCCCATTGTGCGTG
GAGTCGGATATCTCTCCGACGATCAGAAGCGCGAGGCAATCTCCAAACAATTGGGCACAGAGTCCGTTGATGCAA
CTGATATCCGTGGTCTTGTAACGGCAGCAATCCGCAACGAGTTCGACAGTTCATGCGAGGGTCACTGCGTGGCTG
GGTTTGAAGCAGTCAAATCCACACCTGCCAGTGAACAGCCCTTCTGGGTAAACGATACCAAGCTGTCGCACCTGT
TGCGCCTCTCTACTCTCGCTGGCGGGGATGCATTGGCCGAGTCTGCACAGAGCGGTGCCGAGATTTCACCAGCAA
TTGTTATCCGGCAATCGAAGACCCGCGAAGGAGCCGAGGCCATTGTTGGGGCTGCCGTGCTCAACAAGATCTCTA
GCATTCTTATGCGTCCGATGGAAGACCTTGACCCTGCTGCGCCTATCACGGTTTACGGCTTGGACTCGCTGGTCG
GTATCGAGATCCGAAACTGGATCTCCCGCGAGTTGGAAGCTAATTTGCAGATCCTTGAGATTTTGACCAGTGAAT
CTGTCCCGGCTCTTGCCGAGATGATTCTCAAGAAATCGGGTATACTTACTTCAGACCTCAAGGTTGAGTGGGGTC
TTGACATGGCTGAAGGCAGAACCAGCCAAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail