Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g1559.t1
Gene name
Locationscaffold_01:4118934..4120737
Strand-
Gene length (bp)1803
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17433 Glyco_hydro_49N Glycosyl hydrolase family 49 N-terminal Ig-like domain 4.3E-72 30 221
PF03718 Glyco_hydro_49 Glycosyl hydrolase family 49 4.9E-23 487 598
PF18841 B_solenoid_dext Beta solenoid repeat from Dextranase 5.6E-14 361 396
PF18783 IPU_b_solenoid Isopullulanase beta-solenoid repeat 1.8E-12 432 464

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g1559.t1
MITLKSFLLPAIGLQTLAGAFVLPRETDSTPNTHCGSDFCTWWHDTAEINTATAVEAGNVRQSHQYLVQVAAAGS
NTSYDSFVYESIPRNGNGKIQTPGDTSDTFSGDDGISIEIDAGINMAWSQFEYSEDVDVTISRRDGQDVGMDLII
RPSTIAYELSYADNAVIIRVPADENGRKFSVEFGNDLYTFRSDGEAYTTDGSGEVVGIEPINALLIFASPFLSSD
LIPASDGADTVVMTPGAFTANDIGSASIVYFPPGVYYIDSDPLGEAHIKLDPNTYWVYLAPGAYVKGGIEYTTTA
QDFYATGHGVLSGEIYVYQANVDQGYTAVKDDVTSLRMWWHRSVTSGQIWHCVGPTLTSPPFNTMDLMDGSSDRD
DISVDIYDYKQVGAFFMQTDGPQMYTNGSVHDVFYHVNDDAIKTYYSGVTASRLTVWKAFNDPIIQMGWTPREVS
GVTIDTLNIIHSRYRKSENGVPSAIIGASPNYDGSDNVDSSKSISMSISNVYCEGPCPGLFRLTPLQNYKNFSVK
GVSFPDGLIGGSVPVGDTIIASTSDTTYDGSTSLSMELDISGWTVQGQAVTGDNADSLGQFNINSAYSGQWSISS
*
Coding >Pro_DTO070G2_2|g1559.t1
ATGATTACTCTCAAATCTTTTCTACTCCCTGCTATCGGGCTGCAAACCCTAGCTGGGGCGTTTGTTCTACCCCGA
GAAACGGATTCTACCCCCAATACACACTGTGGCTCGGATTTCTGTACCTGGTGGCACGACACGGCCGAGATAAAC
ACAGCCACTGCTGTCGAAGCAGGCAATGTCCGGCAATCTCACCAATATCTCGTTCAGGTTGCCGCTGCTGGGTCG
AACACCTCATACGATTCCTTCGTCTACGAAAGCATTCCTCGCAATGGCAACGGAAAAATCCAGACCCCCGGAGAT
ACCAGCGACACATTCAGCGGCGACGATGGAATTTCAATTGAGATTGATGCTGGCATCAATATGGCGTGGTCCCAG
TTTGAATATAGTGAGGATGTCGATGTCACCATTTCCCGCAGAGACGGTCAGGATGTTGGCATGGACCTTATCATT
CGGCCGAGTACCATTGCGTATGAACTCAGTTACGCGGACAATGCAGTGATCATCCGTGTCCCTGCTGATGAAAAC
GGACGCAAGTTTTCCGTGGAGTTCGGCAACGACCTTTACACCTTCCGGTCTGATGGAGAAGCTTATACCACCGAC
GGATCAGGGGAAGTCGTTGGGATTGAACCCATCAACGCTCTGCTCATCTTCGCCAGCCCATTCCTCTCAAGTGAT
CTTATCCCAGCCAGCGATGGTGCCGACACCGTGGTGATGACACCTGGTGCATTCACCGCAAATGACATTGGCTCG
GCATCTATTGTCTACTTCCCGCCCGGCGTGTACTATATCGACTCGGACCCTCTGGGTGAAGCTCACATCAAGCTC
GATCCTAACACCTACTGGGTGTACCTTGCCCCTGGAGCGTATGTGAAAGGAGGAATCGAATACACCACTACAGCC
CAGGACTTTTACGCCACAGGCCACGGTGTTTTGTCTGGGGAAATCTACGTCTACCAAGCAAACGTGGACCAAGGC
TACACAGCAGTCAAAGATGACGTGACTAGTCTTCGAATGTGGTGGCACCGGAGCGTCACAAGCGGCCAAATCTGG
CACTGTGTCGGACCGACTCTGACTTCGCCCCCGTTCAACACCATGGATTTGATGGATGGAAGTTCCGACCGAGAC
GACATCTCGGTTGATATCTACGATTACAAGCAGGTCGGGGCCTTCTTCATGCAGACTGATGGCCCTCAGATGTAC
ACCAATGGCAGTGTGCACGATGTCTTCTACCATGTGAACGATGACGCTATCAAGACGTATTATTCTGGAGTCACT
GCATCCCGGCTCACAGTGTGGAAGGCCTTCAACGATCCGATCATCCAGATGGGCTGGACACCTCGCGAAGTTTCC
GGCGTTACCATCGATACACTCAATATCATCCACTCACGCTATCGCAAGAGCGAGAACGGTGTTCCTTCGGCCATT
ATTGGTGCTTCGCCAAACTACGACGGCAGCGACAATGTTGATAGCTCCAAGTCAATCAGCATGAGCATTTCCAAC
GTCTACTGCGAGGGTCCTTGCCCTGGCCTTTTCCGTCTTACTCCTCTGCAGAACTATAAGAACTTCAGTGTAAAG
GGAGTATCCTTCCCAGATGGACTGATCGGTGGCAGTGTCCCCGTCGGAGACACCATCATTGCTTCTACAAGTGAT
ACCACTTACGATGGATCGACTAGTCTCTCCATGGAGCTGGACATTTCGGGATGGACCGTCCAAGGGCAAGCAGTG
ACTGGAGACAATGCAGACTCTTTGGGTCAATTCAACATCAATAGTGCCTACTCTGGACAGTGGTCAATTTCTTCT
TGA
Transcript >Pro_DTO070G2_2|g1559.t1
ATGATTACTCTCAAATCTTTTCTACTCCCTGCTATCGGGCTGCAAACCCTAGCTGGGGCGTTTGTTCTACCCCGA
GAAACGGATTCTACCCCCAATACACACTGTGGCTCGGATTTCTGTACCTGGTGGCACGACACGGCCGAGATAAAC
ACAGCCACTGCTGTCGAAGCAGGCAATGTCCGGCAATCTCACCAATATCTCGTTCAGGTTGCCGCTGCTGGGTCG
AACACCTCATACGATTCCTTCGTCTACGAAAGCATTCCTCGCAATGGCAACGGAAAAATCCAGACCCCCGGAGAT
ACCAGCGACACATTCAGCGGCGACGATGGAATTTCAATTGAGATTGATGCTGGCATCAATATGGCGTGGTCCCAG
TTTGAATATAGTGAGGATGTCGATGTCACCATTTCCCGCAGAGACGGTCAGGATGTTGGCATGGACCTTATCATT
CGGCCGAGTACCATTGCGTATGAACTCAGTTACGCGGACAATGCAGTGATCATCCGTGTCCCTGCTGATGAAAAC
GGACGCAAGTTTTCCGTGGAGTTCGGCAACGACCTTTACACCTTCCGGTCTGATGGAGAAGCTTATACCACCGAC
GGATCAGGGGAAGTCGTTGGGATTGAACCCATCAACGCTCTGCTCATCTTCGCCAGCCCATTCCTCTCAAGTGAT
CTTATCCCAGCCAGCGATGGTGCCGACACCGTGGTGATGACACCTGGTGCATTCACCGCAAATGACATTGGCTCG
GCATCTATTGTCTACTTCCCGCCCGGCGTGTACTATATCGACTCGGACCCTCTGGGTGAAGCTCACATCAAGCTC
GATCCTAACACCTACTGGGTGTACCTTGCCCCTGGAGCGTATGTGAAAGGAGGAATCGAATACACCACTACAGCC
CAGGACTTTTACGCCACAGGCCACGGTGTTTTGTCTGGGGAAATCTACGTCTACCAAGCAAACGTGGACCAAGGC
TACACAGCAGTCAAAGATGACGTGACTAGTCTTCGAATGTGGTGGCACCGGAGCGTCACAAGCGGCCAAATCTGG
CACTGTGTCGGACCGACTCTGACTTCGCCCCCGTTCAACACCATGGATTTGATGGATGGAAGTTCCGACCGAGAC
GACATCTCGGTTGATATCTACGATTACAAGCAGGTCGGGGCCTTCTTCATGCAGACTGATGGCCCTCAGATGTAC
ACCAATGGCAGTGTGCACGATGTCTTCTACCATGTGAACGATGACGCTATCAAGACGTATTATTCTGGAGTCACT
GCATCCCGGCTCACAGTGTGGAAGGCCTTCAACGATCCGATCATCCAGATGGGCTGGACACCTCGCGAAGTTTCC
GGCGTTACCATCGATACACTCAATATCATCCACTCACGCTATCGCAAGAGCGAGAACGGTGTTCCTTCGGCCATT
ATTGGTGCTTCGCCAAACTACGACGGCAGCGACAATGTTGATAGCTCCAAGTCAATCAGCATGAGCATTTCCAAC
GTCTACTGCGAGGGTCCTTGCCCTGGCCTTTTCCGTCTTACTCCTCTGCAGAACTATAAGAACTTCAGTGTAAAG
GGAGTATCCTTCCCAGATGGACTGATCGGTGGCAGTGTCCCCGTCGGAGACACCATCATTGCTTCTACAAGTGAT
ACCACTTACGATGGATCGACTAGTCTCTCCATGGAGCTGGACATTTCGGGATGGACCGTCCAAGGGCAAGCAGTG
ACTGGAGACAATGCAGACTCTTTGGGTCAATTCAACATCAATAGTGCCTACTCTGGACAGTGGTCAATTTCTTCT
TGA
Gene >Pro_DTO070G2_2|g1559.t1
ATGATTACTCTCAAATCTTTTCTACTCCCTGCTATCGGGCTGCAAACCCTAGCTGGGGCGTTTGTTCTACCCCGA
GAAACGGATTCTACCCCCAATACACACTGTGGCTCGGATTTCTGTACCTGGTGGCACGACACGGCCGAGATAAAC
ACAGCCACTGCTGTCGAAGCAGGCAATGTCCGGCAATCTCACCAATATCTCGTTCAGGTTGCCGCTGCTGGGTCG
AACACCTCATACGATTCCTTCGTCTACGAAAGCATTCCTCGCAATGGCAACGGAAAAATCCAGACCCCCGGAGAT
ACCAGCGACACATTCAGCGGCGACGATGGAATTTCAATTGAGATTGATGCTGGCATCAATATGGCGTGGTCCCAG
TTTGAATATAGTGAGGATGTCGATGTCACCATTTCCCGCAGAGACGGTCAGGATGTTGGCATGGACCTTATCATT
CGGCCGAGTACCATTGCGTATGAACTCAGTTACGCGGACAATGCAGTGATCATCCGTGTCCCTGCTGATGAAAAC
GGACGCAAGTTTTCCGTGGAGTTCGGCAACGACCTTTACACCTTCCGGTCTGATGGAGAAGCTTATACCACCGAC
GGATCAGGGGAAGTCGTTGGGATTGAACCCATCAACGCTCTGCTCATCTTCGCCAGCCCATTCCTCTCAAGTGAT
CTTATCCCAGCCAGCGATGGTGCCGACACCGTGGTGATGACACCTGGTGCATTCACCGCAAATGACATTGGCTCG
GCATCTATTGTCTACTTCCCGCCCGGCGTGTACTATATCGACTCGGACCCTCTGGGTGAAGCTCACATCAAGCTC
GATCCTAACACCTACTGGGTGTACCTTGCCCCTGGAGCGTATGTGAAAGGAGGAATCGAATACACCACTACAGCC
CAGGACTTTTACGCCACAGGCCACGGTGTTTTGTCTGGGGAAATCTACGTCTACCAAGCAAACGTGGACCAAGGC
TACACAGCAGTCAAAGATGACGTGACTAGTCTTCGAATGTGGTGGCACCGGAGCGTCACAAGCGGCCAAATCTGG
CACTGTGTCGGACCGACTCTGACTTCGCCCCCGTTCAACACCATGGATTTGATGGATGGAAGTTCCGACCGAGAC
GACATCTCGGTTGATATCTACGATTACAAGCAGGTCGGGGCCTTCTTCATGCAGACTGATGGCCCTCAGATGTAC
ACCAATGGCAGTGTGCACGATGTCTTCTACCATGTGAACGATGACGCTATCAAGACGTATTATTCTGGAGTCACT
GCATCCCGGCTCACAGTGTGGAAGGCCTTCAACGATCCGATCATCCAGATGGGCTGGACACCTCGCGAAGTTTCC
GGCGTTACCATCGATACACTCAATATCATCCACTCACGCTATCGCAAGAGCGAGAACGGTGTTCCTTCGGCCATT
ATTGGTGCTTCGCCAAACTACGACGGCAGCGACAATGTTGATAGCTCCAAGTCAATCAGCATGAGCATTTCCAAC
GTCTACTGCGAGGGTCCTTGCCCTGGCCTTTTCCGTCTTACTCCTCTGCAGAACTATAAGAACTTCAGTGTAAAG
GGAGTATCCTTCCCAGATGGACTGATCGGTGGCAGTGTCCCCGTCGGAGACACCATCATTGCTTCTACAAGTGAT
ACCACTTACGATGGATCGACTAGTCTCTCCATGGAGCTGGACATTTCGGGATGGACCGTCCAAGGGCAAGCAGTG
ACTGGAGACAATGCAGACTCTTTGGGTCAATTCAACATCAATAGTGCCTACTCTGGACAGTGGTCAATTTCTTCT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail