Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g1265.t1
Gene name
Locationscaffold_01:3377889..3379788
Strand-
Gene length (bp)1899
Transcript length (bp)1710
Coding sequence length (bp)1710
Protein length (aa) 570

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12999 PRKCSH-like Glucosidase II beta subunit-like 5.0E-17 26 79
PF12999 PRKCSH-like Glucosidase II beta subunit-like 3.0E-26 105 205
PF13015 PRKCSH_1 Glucosidase II beta subunit-like protein 7.5E-34 406 553
PF07915 PRKCSH Glucosidase II beta subunit-like protein 8.6E-07 442 511

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g1265.t1
MRLPQSLFLLAAAGSAVQASSDKPARPRGLGPEFAKFYQDSTTFTCISNPSVKIPFSAVNDDYCDCPDGSDEPGT
SACAHISRNSPLTVADRPGNSELDTVLALPGFYCKNKGHRPSYLPFQRINDGICDYEECCDGSDEWARVGGTKCE
DRCKEIGKQWRKQEEQNQKSMNAALRKKKDLLVDAGRQQQELEDHIAALEAEVQGAELKEQNLEADLKLAQEQDR
KVVRTGNGKGNGKVNALANLAKGRVDELRNALVDVRRQRDEVRERVKELEDILAKVKVEYNPNFNDEGVKRAVRS
YEDYAAREQGTEGVNAAVDRDLDEIAKADGEEHGINWEHWENEEDGCNDSDLVYKLAAYLPPSLVSFIEDRAVSV
RSYLEEKGILPKADKDSSSESKAVTQARDALKAAQDTVTSIKNKLRDHRADLEQDYGPNSIFRALKGVCITQDAG
EYTYEHCFLESTKQNQRKGSNSVSMGKFSNVGTTTVEEVNAAGEVVNVEKMTIQYNNGQSCWNGPNRSTKVILEC
GEENKILKTAEEEKCVYAMLVTSPAACASGEEAGNVAPRSKDEL*
Coding >Pro_DTO070G2_2|g1265.t1
ATGAGACTTCCTCAGTCGTTATTCTTGCTGGCTGCCGCTGGGTCGGCGGTCCAGGCTAGTAGTGACAAGCCTGCC
CGTCCCCGTGGCTTGGGCCCAGAATTTGCCAAATTCTACCAGGACTCAACGACATTCACCTGTATCTCGAATCCC
TCGGTCAAAATCCCCTTCTCGGCCGTCAACGATGACTACTGTGACTGCCCCGACGGAAGCGACGAGCCTGGCACG
TCTGCCTGCGCACATATTTCGCGCAATTCGCCACTAACGGTGGCCGACCGGCCTGGGAATAGCGAATTAGACACC
GTACTCGCTCTTCCGGGATTCTACTGCAAAAACAAGGGCCACCGGCCATCATACCTTCCATTCCAGCGTATCAAC
GATGGTATCTGTGATTATGAGGAGTGTTGTGATGGTAGCGATGAGTGGGCTCGCGTTGGAGGCACCAAATGTGAA
GACCGATGCAAGGAGATTGGCAAGCAATGGCGGAAGCAGGAGGAACAGAACCAAAAGTCGATGAATGCTGCCCTG
AGGAAGAAGAAGGACCTTCTTGTTGATGCTGGTCGCCAGCAGCAGGAGCTCGAGGACCATATTGCTGCGCTCGAG
GCCGAGGTTCAGGGTGCTGAGCTCAAGGAACAGAACCTCGAGGCTGATCTGAAGCTCGCCCAGGAGCAGGACCGC
AAGGTGGTTCGTACTGGAAATGGCAAAGGTAATGGCAAGGTCAATGCCCTTGCAAACTTGGCCAAGGGCCGTGTT
GACGAGCTACGCAATGCGTTGGTCGATGTGCGTCGGCAGCGGGATGAAGTCCGCGAGCGGGTGAAGGAGCTTGAG
GATATTCTGGCTAAGGTCAAGGTGGAATATAACCCCAATTTCAATGACGAGGGTGTCAAACGTGCGGTCCGTAGC
TATGAGGACTACGCTGCTCGTGAGCAAGGCACCGAGGGTGTGAACGCTGCCGTCGACCGTGACTTAGACGAGATT
GCCAAAGCCGACGGTGAAGAACATGGTATTAACTGGGAACACTGGGAAAACGAGGAGGATGGATGCAACGACTCG
GATTTAGTGTACAAGCTCGCTGCTTATCTCCCACCCTCGCTTGTCAGCTTCATTGAGGATAGGGCCGTTTCTGTT
AGGAGCTACCTTGAAGAAAAGGGCATTCTTCCCAAGGCCGATAAAGACTCTTCCTCGGAATCCAAGGCCGTGACC
CAAGCACGCGATGCCCTTAAGGCCGCGCAAGATACTGTTACAAGCATCAAGAACAAGCTCCGCGACCACCGTGCC
GACCTTGAGCAGGACTATGGCCCTAACTCCATCTTCCGCGCGCTCAAGGGGGTATGTATCACCCAGGATGCGGGT
GAGTACACGTACGAGCATTGCTTCCTTGAGTCGACCAAGCAGAACCAGAGAAAGGGAAGCAATTCTGTGTCGATG
GGCAAATTCTCGAATGTTGGAACTACGACCGTAGAAGAGGTCAACGCGGCTGGCGAGGTCGTCAATGTCGAGAAG
ATGACGATTCAATACAATAACGGCCAGTCTTGTTGGAATGGACCTAACCGGTCGACCAAGGTCATTTTAGAGTGC
GGTGAGGAGAACAAGATCTTGAAGACGGCGGAAGAGGAGAAGTGCGTGTATGCCATGCTTGTTACCTCGCCGGCT
GCATGTGCAAGTGGTGAGGAAGCAGGTAATGTTGCGCCTCGCTCGAAAGACGAGCTGTGA
Transcript >Pro_DTO070G2_2|g1265.t1
ATGAGACTTCCTCAGTCGTTATTCTTGCTGGCTGCCGCTGGGTCGGCGGTCCAGGCTAGTAGTGACAAGCCTGCC
CGTCCCCGTGGCTTGGGCCCAGAATTTGCCAAATTCTACCAGGACTCAACGACATTCACCTGTATCTCGAATCCC
TCGGTCAAAATCCCCTTCTCGGCCGTCAACGATGACTACTGTGACTGCCCCGACGGAAGCGACGAGCCTGGCACG
TCTGCCTGCGCACATATTTCGCGCAATTCGCCACTAACGGTGGCCGACCGGCCTGGGAATAGCGAATTAGACACC
GTACTCGCTCTTCCGGGATTCTACTGCAAAAACAAGGGCCACCGGCCATCATACCTTCCATTCCAGCGTATCAAC
GATGGTATCTGTGATTATGAGGAGTGTTGTGATGGTAGCGATGAGTGGGCTCGCGTTGGAGGCACCAAATGTGAA
GACCGATGCAAGGAGATTGGCAAGCAATGGCGGAAGCAGGAGGAACAGAACCAAAAGTCGATGAATGCTGCCCTG
AGGAAGAAGAAGGACCTTCTTGTTGATGCTGGTCGCCAGCAGCAGGAGCTCGAGGACCATATTGCTGCGCTCGAG
GCCGAGGTTCAGGGTGCTGAGCTCAAGGAACAGAACCTCGAGGCTGATCTGAAGCTCGCCCAGGAGCAGGACCGC
AAGGTGGTTCGTACTGGAAATGGCAAAGGTAATGGCAAGGTCAATGCCCTTGCAAACTTGGCCAAGGGCCGTGTT
GACGAGCTACGCAATGCGTTGGTCGATGTGCGTCGGCAGCGGGATGAAGTCCGCGAGCGGGTGAAGGAGCTTGAG
GATATTCTGGCTAAGGTCAAGGTGGAATATAACCCCAATTTCAATGACGAGGGTGTCAAACGTGCGGTCCGTAGC
TATGAGGACTACGCTGCTCGTGAGCAAGGCACCGAGGGTGTGAACGCTGCCGTCGACCGTGACTTAGACGAGATT
GCCAAAGCCGACGGTGAAGAACATGGTATTAACTGGGAACACTGGGAAAACGAGGAGGATGGATGCAACGACTCG
GATTTAGTGTACAAGCTCGCTGCTTATCTCCCACCCTCGCTTGTCAGCTTCATTGAGGATAGGGCCGTTTCTGTT
AGGAGCTACCTTGAAGAAAAGGGCATTCTTCCCAAGGCCGATAAAGACTCTTCCTCGGAATCCAAGGCCGTGACC
CAAGCACGCGATGCCCTTAAGGCCGCGCAAGATACTGTTACAAGCATCAAGAACAAGCTCCGCGACCACCGTGCC
GACCTTGAGCAGGACTATGGCCCTAACTCCATCTTCCGCGCGCTCAAGGGGGTATGTATCACCCAGGATGCGGGT
GAGTACACGTACGAGCATTGCTTCCTTGAGTCGACCAAGCAGAACCAGAGAAAGGGAAGCAATTCTGTGTCGATG
GGCAAATTCTCGAATGTTGGAACTACGACCGTAGAAGAGGTCAACGCGGCTGGCGAGGTCGTCAATGTCGAGAAG
ATGACGATTCAATACAATAACGGCCAGTCTTGTTGGAATGGACCTAACCGGTCGACCAAGGTCATTTTAGAGTGC
GGTGAGGAGAACAAGATCTTGAAGACGGCGGAAGAGGAGAAGTGCGTGTATGCCATGCTTGTTACCTCGCCGGCT
GCATGTGCAAGTGGTGAGGAAGCAGGTAATGTTGCGCCTCGCTCGAAAGACGAGCTGTGA
Gene >Pro_DTO070G2_2|g1265.t1
ATGAGACTTCCTCAGTCGTTATTCTTGCTGGCTGCCGCTGGGTCGGCGGTCCAGGCTAGTAGTGACAAGCCTGCC
CGTCCCCGTGGCTTGGGCCCAGAATGTGAGTATCTGAACCCTGACTTTCTAGATCCATTATTTGCATTATTGTTT
GCGGCTGGTTCATGTAGCAGTGATCTATGATAGGCAATTGATCCTCTTATATTAGAGATTACACTAATATAGTAT
CCTTAGTTGCCAAATTCTACCAGGACTCAACGACATTCACCTGTATCTCGAATCCCTCGGTCAAAATCCCCTTCT
CGGCCGTCAACGATGACTACTGTGACTGCCCCGACGGAAGCGACGAGCCTGGCACGTCTGCCTGCGCACATATTT
CGCGCAATTCGCCACTAACGGTGGCCGACCGGCCTGGGAATAGCGAATTAGACACCGTACTCGCTCTTCCGGGAT
TCTACTGCAAAAACAAGGGCCACCGGCCATCATACCTTCCATTCCAGCGTATCAACGATGGTATCTGTGATTATG
AGGAGTGTTGTGATGGTAGCGATGAGTGGGCTCGCGTTGGAGGCACCAAATGTGAAGACCGATGCAAGGAGATTG
GCAAGCAATGGCGGAAGCAGGAGGAACAGAACCAAAAGTCGATGAATGCTGCCCTGAGGAAGAAGAAGGACCTTC
TTGTTGATGCTGGTCGCCAGCAGCAGGAGCTCGAGGACCATATTGCTGCGCTCGAGGCCGAGGTTCAGGGTGCTG
AGCTCAAGGAACAGAACCTCGAGGCTGATCTGAAGCTCGCCCAGGAGCAGGACCGCAAGGTGGTTCGTACTGGAA
ATGGCAAAGGTAATGGCAAGGTCAATGCCCTTGCAAACTTGGCCAAGGGCCGTGTTGACGAGCTACGCAATGCGT
TGGTCGATGTGCGTCGGCAGCGGGATGAAGTCCGCGAGCGGGTGAAGGAGCTTGAGGATATTCTGGCTAAGGTCA
AGGTGGAATATAACCCCAATTTCAATGACGAGGGTGTCAAACGTGCGGTCCGTAGCTATGAGGACTACGCTGCTC
GTGAGCAAGGCACCGAGGGTGTGAACGCTGCCGTCGACCGTGACTTAGACGAGATTGCCAAAGCCGACGGTGAAG
AACATGGTATTAACTGGGAACACTGGGAAAACGAGGAGGATGGATGCAACGACTCGGATTTAGGTAAGATATTCC
GTGATTCCTTGTGACACCTTGTATAGCTTACCAACAGGAACTATAGTGTACAAGCTCGCTGCTTATCTCCCACCC
TCGCTTGTCAGCTTCATTGAGGATAGGGCCGTTTCTGTTAGGAGCTACCTTGAAGAAAAGGGCATTCTTCCCAAG
GCCGATAAAGACTCTTCCTCGGAATCCAAGGCCGTGACCCAAGCACGCGATGCCCTTAAGGCCGCGCAAGATACT
GTTACAAGCATCAAGAACAAGCTCCGCGACCACCGTGCCGACCTTGAGCAGGACTATGGCCCTAACTCCATCTTC
CGCGCGCTCAAGGGGGTATGTATCACCCAGGATGCGGGTGAGTACACGTACGAGCATTGCTTCCTTGAGTCGACC
AAGCAGAACCAGAGAAAGGGAAGCAATTCTGTGTCGATGGGCAAATTCTCGAATGTTGGAACTACGACCGTAGAA
GAGGTCAACGCGGCTGGCGAGGTCGTCAATGTCGAGAAGATGACGATTCAATACAATAACGGCCAGTCTTGTTGG
AATGGACCTAACCGGTCGACCAAGGTCATTTTAGAGTGCGGTGAGGAGAACAAGATCTTGAAGACGGCGGAAGAG
GAGAAGTGCGTGTATGCCATGCTTGTTACCTCGCCGGCTGCATGTGCAAGTGGTGAGGAAGCAGGTAATGTTGCG
CCTCGCTCGAAAGACGAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail