Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g125.t1
Gene name
Locationscaffold_01:337752..340146
Strand-
Gene length (bp)2394
Transcript length (bp)2256
Coding sequence length (bp)2256
Protein length (aa) 752

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 1.3E-21 230 463
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 2.5E-18 330 516
PF00535 Glycos_transf_2 Glycosyl transferase family 2 1.2E-13 232 411
PF03552 Cellulose_synt Cellulose synthase 6.7E-08 387 535
PF13506 Glyco_transf_21 Glycosyl transferase family 21 3.2E-10 326 462

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016020 membrane Yes
GO:0016760 cellulose synthase (UDP-forming) activity Yes
GO:0030244 cellulose biosynthetic process Yes
GO:0008150 biological_process No
GO:0044249 cellular biosynthetic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0000271 polysaccharide biosynthetic process No
GO:0008152 metabolic process No
GO:0044264 cellular polysaccharide metabolic process No
GO:0006073 cellular glucan metabolic process No
GO:0005575 cellular_component No
GO:0016740 transferase activity No
GO:0009987 cellular process No
GO:0009250 glucan biosynthetic process No
GO:0009058 biosynthetic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0051273 beta-glucan metabolic process No
GO:0030243 cellulose metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044238 primary metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0051274 beta-glucan biosynthetic process No
GO:0003824 catalytic activity No
GO:0035251 UDP-glucosyltransferase activity No
GO:0005976 polysaccharide metabolic process No
GO:0044237 cellular metabolic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0044042 glucan metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0033692 cellular polysaccharide biosynthetic process No
GO:0016759 cellulose synthase activity No
GO:0046527 glucosyltransferase activity No
GO:0003674 molecular_function No
GO:0034637 cellular carbohydrate biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 147 169 22
2 182 204 22
3 497 519 22
4 532 554 22
5 569 591 22
6 624 646 22
7 661 683 22
8 727 749 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT2_Glyco_tranf_2_3 4.9E-23 230 463

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup4888
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g5486.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g8551.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g6474.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g2241.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g3856.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g3855.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g8067.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g7168.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g5479.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g5996.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g4604.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g3519.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g5210.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g9063.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g8202.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g1071.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g5460.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g2614.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g125.t1 (this protein)
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g176.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g960.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g4660.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g3942.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g9489.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g6632.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g3196.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g6299.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g195.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g1616.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g8140.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g4487.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g6081.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g9489.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g6804.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g125.t1
MDRRGGHDEDEKVELNAYPANHSNHSFESQPFSPSPVTPRPLTPVRPGHFPTDEYGQPVWLQPTARMSGNSDSFH
NSSWDLRTPYDSRSASPTLYQNNGVQESHQSLAPLVSSPAPPGFAKDWVKSGSIARINDRDDADTWKGWKRWVFA
LVPFLTFANTGIYLFYLGLRIACIIMAQNVSGVSYAGAWVFVAIEITVAIPSLMHNCWTMMALKKRGRAKLRLTG
NDCPTVDVFITCCGEDDEVVLDTVRGACDQDYPPDQMRVIILDDAKSATLEAGCNQLAVNHPNIIYMAREKIPGK
PHHFKAGNLNYGLEQVTLLPGGAGQFMAALDADMIPEQEWLRAILPHLLVDPKMALACPPQLFYNTPASDPLAQS
LDFFVHVIEPIKDALGVAWCTGSGYVVRREALEEIGNFPLGSLAEDVATSTLMLGKGWKTAYIHEPLQFGTVPED
FGGHLKQRTRWAIGTVDTAAKLKFCLWGDAVRQMTAAQRFSGFLYATLSVYTLLLTASLFAIPIILLWGKRLVAF
ATEEQLRWLIWSCFAATISNRLCELALFIPAGYNTGQRGSRYQLWMSPYIALCIVRAFILPTWLGGQTQAFKPTG
SLGSALNERDPNKSKNMFVRLRVILLNYMASFHLAFVYVTLIGVVISSYRCFAQNSGFRDIILCLITHAFWPPLT
FLFICTSLWTPVSYAIDPPRMPEREELLTRDPKTGVAHPTKKSKKIAFGGQAAWFELEYTVATVVTILVFIYSFM
F*
Coding >Pro_DTO070G2_2|g125.t1
ATGGACAGGCGTGGTGGTCATGACGAGGACGAAAAGGTAGAACTGAATGCCTATCCTGCCAACCATTCAAACCAC
AGCTTCGAATCTCAGCCTTTTTCACCCTCACCAGTAACTCCAAGGCCTCTCACTCCAGTCAGACCGGGTCATTTC
CCTACCGATGAATACGGGCAACCCGTTTGGCTTCAACCCACCGCTCGAATGTCGGGCAACTCCGATTCCTTTCAC
AACTCCTCCTGGGACCTACGAACGCCGTATGATTCCCGGTCGGCTTCACCCACTCTATATCAAAACAATGGAGTG
CAAGAAAGCCACCAGAGTCTAGCTCCCCTAGTGAGCTCCCCGGCTCCCCCGGGATTTGCAAAGGATTGGGTCAAG
TCTGGATCGATTGCTCGAATTAACGACCGTGATGATGCGGATACATGGAAAGGGTGGAAGAGATGGGTATTTGCC
CTGGTACCGTTTCTCACATTCGCCAACACCGGAATCTACTTGTTCTACCTCGGGCTGAGAATTGCCTGCATTATC
ATGGCTCAAAATGTTTCTGGAGTTTCATATGCCGGAGCTTGGGTTTTTGTGGCTATCGAGATCACTGTTGCAATC
CCCTCCCTCATGCACAACTGTTGGACTATGATGGCGTTGAAGAAGAGAGGCCGTGCCAAGCTGAGATTGACCGGC
AATGACTGTCCGACAGTGGATGTGTTTATTACCTGCTGTGGAGAGGATGATGAAGTGGTCCTCGATACTGTCCGT
GGTGCGTGTGACCAGGACTACCCTCCCGACCAGATGAGGGTTATCATCTTGGACGACGCCAAGTCTGCCACCCTC
GAGGCTGGCTGCAACCAACTCGCTGTGAATCACCCCAACATCATTTACATGGCTCGTGAAAAGATCCCCGGAAAA
CCCCACCACTTCAAGGCAGGTAATCTGAACTACGGTCTGGAGCAGGTCACCCTTTTGCCTGGAGGCGCCGGCCAG
TTCATGGCCGCCCTGGACGCTGATATGATTCCTGAACAAGAGTGGCTTCGTGCGATTCTTCCCCACTTGTTGGTG
GATCCCAAAATGGCCCTTGCATGCCCGCCGCAGCTTTTCTACAATACCCCTGCATCCGACCCGCTTGCCCAGAGT
TTGGATTTCTTCGTGCATGTTATTGAGCCGATCAAGGATGCCCTCGGTGTGGCTTGGTGCACTGGATCTGGTTAC
GTCGTTCGACGCGAGGCGCTCGAAGAGATTGGCAACTTCCCGCTCGGTTCCTTGGCTGAAGATGTCGCGACCTCC
ACACTCATGCTTGGCAAAGGATGGAAAACCGCATACATCCACGAGCCGCTTCAATTTGGTACCGTGCCGGAAGAC
TTTGGTGGACATCTCAAGCAGCGTACGCGATGGGCAATTGGAACCGTCGACACCGCTGCCAAGCTGAAGTTCTGT
CTCTGGGGTGACGCCGTTCGACAGATGACCGCTGCTCAACGATTCTCCGGCTTCCTCTATGCAACTCTCAGTGTC
TATACCCTCCTGCTCACCGCTTCCCTCTTTGCTATCCCGATCATCCTCTTGTGGGGCAAGCGCCTTGTCGCCTTT
GCGACAGAAGAGCAACTCCGCTGGCTGATCTGGTCCTGCTTCGCCGCCACTATCTCCAACCGTCTGTGCGAACTG
GCCCTGTTCATCCCGGCGGGCTATAACACCGGCCAGCGAGGCTCCCGCTATCAACTTTGGATGTCACCCTATATC
GCTCTCTGTATTGTGCGCGCCTTCATCCTCCCCACCTGGCTGGGCGGTCAAACCCAAGCCTTCAAGCCCACTGGT
TCGCTGGGCTCAGCTCTGAACGAGCGCGACCCGAACAAGTCCAAGAACATGTTCGTCCGCCTGCGCGTGATCTTA
CTCAACTACATGGCCAGCTTCCACCTTGCCTTTGTCTACGTCACCCTCATCGGAGTCGTCATCTCCTCTTACCGC
TGTTTCGCCCAGAACAGTGGCTTCCGAGATATCATCCTCTGCCTCATCACGCATGCTTTCTGGCCTCCACTGACC
TTCCTTTTCATTTGCACTTCGCTGTGGACCCCGGTCTCGTATGCGATCGACCCGCCACGCATGCCGGAGCGTGAA
GAACTCCTTACACGTGACCCTAAGACTGGTGTGGCGCACCCGACGAAGAAGAGTAAAAAGATCGCCTTCGGTGGC
CAGGCCGCTTGGTTCGAGCTTGAATACACGGTTGCCACCGTGGTCACAATTTTGGTCTTCATCTACTCGTTTATG
TTCTAA
Transcript >Pro_DTO070G2_2|g125.t1
ATGGACAGGCGTGGTGGTCATGACGAGGACGAAAAGGTAGAACTGAATGCCTATCCTGCCAACCATTCAAACCAC
AGCTTCGAATCTCAGCCTTTTTCACCCTCACCAGTAACTCCAAGGCCTCTCACTCCAGTCAGACCGGGTCATTTC
CCTACCGATGAATACGGGCAACCCGTTTGGCTTCAACCCACCGCTCGAATGTCGGGCAACTCCGATTCCTTTCAC
AACTCCTCCTGGGACCTACGAACGCCGTATGATTCCCGGTCGGCTTCACCCACTCTATATCAAAACAATGGAGTG
CAAGAAAGCCACCAGAGTCTAGCTCCCCTAGTGAGCTCCCCGGCTCCCCCGGGATTTGCAAAGGATTGGGTCAAG
TCTGGATCGATTGCTCGAATTAACGACCGTGATGATGCGGATACATGGAAAGGGTGGAAGAGATGGGTATTTGCC
CTGGTACCGTTTCTCACATTCGCCAACACCGGAATCTACTTGTTCTACCTCGGGCTGAGAATTGCCTGCATTATC
ATGGCTCAAAATGTTTCTGGAGTTTCATATGCCGGAGCTTGGGTTTTTGTGGCTATCGAGATCACTGTTGCAATC
CCCTCCCTCATGCACAACTGTTGGACTATGATGGCGTTGAAGAAGAGAGGCCGTGCCAAGCTGAGATTGACCGGC
AATGACTGTCCGACAGTGGATGTGTTTATTACCTGCTGTGGAGAGGATGATGAAGTGGTCCTCGATACTGTCCGT
GGTGCGTGTGACCAGGACTACCCTCCCGACCAGATGAGGGTTATCATCTTGGACGACGCCAAGTCTGCCACCCTC
GAGGCTGGCTGCAACCAACTCGCTGTGAATCACCCCAACATCATTTACATGGCTCGTGAAAAGATCCCCGGAAAA
CCCCACCACTTCAAGGCAGGTAATCTGAACTACGGTCTGGAGCAGGTCACCCTTTTGCCTGGAGGCGCCGGCCAG
TTCATGGCCGCCCTGGACGCTGATATGATTCCTGAACAAGAGTGGCTTCGTGCGATTCTTCCCCACTTGTTGGTG
GATCCCAAAATGGCCCTTGCATGCCCGCCGCAGCTTTTCTACAATACCCCTGCATCCGACCCGCTTGCCCAGAGT
TTGGATTTCTTCGTGCATGTTATTGAGCCGATCAAGGATGCCCTCGGTGTGGCTTGGTGCACTGGATCTGGTTAC
GTCGTTCGACGCGAGGCGCTCGAAGAGATTGGCAACTTCCCGCTCGGTTCCTTGGCTGAAGATGTCGCGACCTCC
ACACTCATGCTTGGCAAAGGATGGAAAACCGCATACATCCACGAGCCGCTTCAATTTGGTACCGTGCCGGAAGAC
TTTGGTGGACATCTCAAGCAGCGTACGCGATGGGCAATTGGAACCGTCGACACCGCTGCCAAGCTGAAGTTCTGT
CTCTGGGGTGACGCCGTTCGACAGATGACCGCTGCTCAACGATTCTCCGGCTTCCTCTATGCAACTCTCAGTGTC
TATACCCTCCTGCTCACCGCTTCCCTCTTTGCTATCCCGATCATCCTCTTGTGGGGCAAGCGCCTTGTCGCCTTT
GCGACAGAAGAGCAACTCCGCTGGCTGATCTGGTCCTGCTTCGCCGCCACTATCTCCAACCGTCTGTGCGAACTG
GCCCTGTTCATCCCGGCGGGCTATAACACCGGCCAGCGAGGCTCCCGCTATCAACTTTGGATGTCACCCTATATC
GCTCTCTGTATTGTGCGCGCCTTCATCCTCCCCACCTGGCTGGGCGGTCAAACCCAAGCCTTCAAGCCCACTGGT
TCGCTGGGCTCAGCTCTGAACGAGCGCGACCCGAACAAGTCCAAGAACATGTTCGTCCGCCTGCGCGTGATCTTA
CTCAACTACATGGCCAGCTTCCACCTTGCCTTTGTCTACGTCACCCTCATCGGAGTCGTCATCTCCTCTTACCGC
TGTTTCGCCCAGAACAGTGGCTTCCGAGATATCATCCTCTGCCTCATCACGCATGCTTTCTGGCCTCCACTGACC
TTCCTTTTCATTTGCACTTCGCTGTGGACCCCGGTCTCGTATGCGATCGACCCGCCACGCATGCCGGAGCGTGAA
GAACTCCTTACACGTGACCCTAAGACTGGTGTGGCGCACCCGACGAAGAAGAGTAAAAAGATCGCCTTCGGTGGC
CAGGCCGCTTGGTTCGAGCTTGAATACACGGTTGCCACCGTGGTCACAATTTTGGTCTTCATCTACTCGTTTATG
TTCTAA
Gene >Pro_DTO070G2_2|g125.t1
ATGGACAGGCGTGGTGGTCATGACGAGGACGAAAAGGTAGAACTGAATGCCTATCCTGCCAACCATTCAAACCAC
AGCTTCGAATCTCAGCCTTTTTCACCCTCACCAGTAACTCCAAGGCCTCTCACTCCAGTCAGACCGGGTCATTTC
CCTACCGATGAATACGGGCAACCCGTTTGGCTTCAACCCACCGCTCGAATGTCGGGCAACTCCGATTCCTTTCAC
AACTCCTCCTGGGACCTACGAACGCCGTATGATTCCCGGTCGGCTTCACCCACTCTAGTTAGTACAGTCCGTCTT
TGTTTCTTTGGTCTCTTTGTTGTCGGTATAGATCCAGCCTAACCGGTTTCCCATACAGTATCAAAACAATGGAGT
GCAAGAAAGCCACCAGAGTCTAGCTCCCCTAGTGAGCTCCCCGGCTCCCCCGGGATTTGCAAAGGATTGGGTCAA
GTCTGGATCGATTGCTCGAATTAACGACCGTGATGATGCGGATACATGGAAAGGGTGGAAGAGATGGGTATTTGC
CCTGGTACCGTTTCTCACATTCGCCAACACCGGAATCTACTTGTTCTACCTCGGGCTGAGAATTGCCTGCATTAT
CATGGCTCAAAATGTTTCTGGAGTTTCATATGCCGGAGCTTGGGTTTTTGTGGCTATCGAGATCACTGTTGCAAT
CCCCTCCCTCATGCACAACTGTTGGACTATGATGGCGTTGAAGAAGAGAGGCCGTGCCAAGCTGAGATTGACCGG
CAATGACTGTCCGACAGTGGATGTGTTTATTACCTGCTGTGGAGAGGATGATGAAGTGGTCCTCGATACTGTCCG
TGGTGCGTGTGACCAGGACTACCCTCCCGACCAGATGAGGGTTATCATCTTGGACGACGCCAAGTCTGCCACCCT
CGAGGCTGGCTGCAACCAACTCGCTGTGAATCACCCCAACATCATTTACATGGCTCGTGAAAAGATCCCCGGAAA
ACCCCACCACTTCAAGGCAGGTAATCTGAACTACGGTCTGGAGCAGGTCACCCTTTTGCCTGGAGGCGCCGGCCA
GTTCATGGCCGCCCTGGACGCTGATATGGTAAGTTACAGGTCCCGGCCTACGTTGAAATTGAAATTCCTGTACTG
ATTGACAATCTGCAGATTCCTGAACAAGAGTGGCTTCGTGCGATTCTTCCCCACTTGTTGGTGGATCCCAAAATG
GCCCTTGCATGCCCGCCGCAGCTTTTCTACAATACCCCTGCATCCGACCCGCTTGCCCAGAGTTTGGATTTCTTC
GTGCATGTTATTGAGCCGATCAAGGATGCCCTCGGTGTGGCTTGGTGCACTGGATCTGGTTACGTCGTTCGACGC
GAGGCGCTCGAAGAGATTGGCAACTTCCCGCTCGGTTCCTTGGCTGAAGATGTCGCGACCTCCACACTCATGCTT
GGCAAAGGATGGAAAACCGCATACATCCACGAGCCGCTTCAATTTGGTACCGTGCCGGAAGACTTTGGTGGACAT
CTCAAGCAGCGTACGCGATGGGCAATTGGAACCGTCGACACCGCTGCCAAGCTGAAGTTCTGTCTCTGGGGTGAC
GCCGTTCGACAGATGACCGCTGCTCAACGATTCTCCGGCTTCCTCTATGCAACTCTCAGTGTCTATACCCTCCTG
CTCACCGCTTCCCTCTTTGCTATCCCGATCATCCTCTTGTGGGGCAAGCGCCTTGTCGCCTTTGCGACAGAAGAG
CAACTCCGCTGGCTGATCTGGTCCTGCTTCGCCGCCACTATCTCCAACCGTCTGTGCGAACTGGCCCTGTTCATC
CCGGCGGGCTATAACACCGGCCAGCGAGGCTCCCGCTATCAACTTTGGATGTCACCCTATATCGCTCTCTGTATT
GTGCGCGCCTTCATCCTCCCCACCTGGCTGGGCGGTCAAACCCAAGCCTTCAAGCCCACTGGTTCGCTGGGCTCA
GCTCTGAACGAGCGCGACCCGAACAAGTCCAAGAACATGTTCGTCCGCCTGCGCGTGATCTTACTCAACTACATG
GCCAGCTTCCACCTTGCCTTTGTCTACGTCACCCTCATCGGAGTCGTCATCTCCTCTTACCGCTGTTTCGCCCAG
AACAGTGGCTTCCGAGATATCATCCTCTGCCTCATCACGCATGCTTTCTGGCCTCCACTGACCTTCCTTTTCATT
TGCACTTCGCTGTGGACCCCGGTCTCGTATGCGATCGACCCGCCACGCATGCCGGAGCGTGAAGAACTCCTTACA
CGTGACCCTAAGACTGGTGTGGCGCACCCGACGAAGAAGAGTAAAAAGATCGCCTTCGGTGGCCAGGCCGCTTGG
TTCGAGCTTGAATACACGGTTGCCACCGTGGTCACAATTTTGGTCTTCATCTACTCGTTTATGTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail