Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g1027.t1
Gene name
Locationscaffold_01:2741248..2742732
Strand+
Gene length (bp)1484
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase 2.3E-24 28 196
PF03188 Cytochrom_B561 Eukaryotic cytochrome b561 4.3E-09 230 353
PF10348 DUF2427 Domain of unknown function (DUF2427) 8.4E-06 229 313

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 227 249 22
2 258 280 22
3 295 314 19
4 334 356 22
5 360 382 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g1027.t1
MRLPTRPEVVILLGHLFHSIALASAVSDSTTTSIFNLPLSQNQANFIFAINIPDGSTDLYFHMSGPTDYSWIAVG
TGNEMKDSLMFVIYSKANGENITFSPRLSSGEQEPVYSSSIKVDILNGTGISDNVMTVNARCSNCTQWETGSLDL
KSTSQPWIFGLGPTGSSAAMLRSNSQTANIERHSEYGIFTMDMVRATGGSGGLPTSYTNSTGSVLSKSITNDSNW
PSIIHGLCLCGALILLMPAGVVLLRVAPKSVRWHWINQTLSSAIAIVGIIIGFYLSTMFTKSQNYGSAHQILGII
LLLAMLAQWGMGFWHHRVYKQTKSPTRFGIIHRYFGHIIIFLAIVNGGIGLTWSSASKSVVIGYSIAVIIIGLGL
VLIIGWARWISRHGQQGFTSAPVNLRGLSGDDSHDYLDQHSDILPYNPYGRL*
Coding >Pro_DTO070G2_2|g1027.t1
ATGCGACTGCCTACAAGGCCCGAAGTCGTGATTTTGCTAGGCCATTTATTTCACTCTATTGCCCTTGCGTCTGCC
GTGTCCGACTCGACTACTACGAGCATTTTCAATCTGCCTCTTAGCCAGAACCAGGCCAATTTCATTTTTGCTATC
AACATCCCCGATGGCTCCACCGATCTCTACTTCCACATGTCTGGGCCGACGGACTATTCATGGATTGCGGTCGGG
ACTGGAAATGAAATGAAAGACTCTCTCATGTTTGTGATCTACTCCAAGGCCAATGGGGAAAATATTACCTTCAGC
CCTCGTCTCTCCTCCGGTGAACAAGAACCTGTGTATTCATCTTCGATCAAGGTGGACATTCTCAATGGTACAGGT
ATCTCCGATAACGTCATGACCGTGAATGCTAGGTGCTCAAACTGCACCCAGTGGGAGACTGGATCATTGGATTTG
AAATCCACGTCTCAGCCGTGGATTTTTGGGCTAGGTCCAACTGGTAGTTCGGCTGCCATGCTACGCAGTAACTCT
CAAACGGCAAACATAGAGAGACACTCAGAATATGGCATCTTCACTATGGATATGGTCCGCGCAACCGGCGGTTCG
GGTGGACTACCAACGTCGTATACAAACTCAACTGGCTCGGTGCTGAGCAAATCAATTACAAACGACAGCAACTGG
CCTAGCATCATTCACGGTCTGTGCCTTTGTGGAGCTCTCATCCTTCTGATGCCAGCCGGCGTCGTTCTCCTCCGT
GTTGCTCCGAAAAGTGTCCGGTGGCACTGGATCAACCAGACACTTTCTTCAGCAATTGCGATCGTCGGCATAATA
ATCGGCTTTTACCTAAGCACGATGTTCACAAAATCGCAAAACTACGGCTCCGCGCACCAGATCCTTGGTATTATC
CTTCTGCTTGCAATGCTAGCTCAGTGGGGAATGGGATTTTGGCATCACCGGGTATATAAACAGACTAAGTCACCT
ACCAGGTTTGGCATTATCCATCGCTACTTTGGACATATCATCATCTTCCTCGCGATCGTCAACGGAGGCATCGGA
CTTACTTGGTCATCTGCGTCCAAGTCCGTTGTAATAGGATATTCCATCGCTGTGATCATTATTGGGCTTGGGCTT
GTGCTTATCATTGGTTGGGCAAGGTGGATATCCAGACATGGCCAACAGGGTTTTACAAGTGCGCCTGTCAATCTC
CGAGGACTTAGTGGTGATGATTCCCACGATTACCTTGATCAGCACTCGGACATACTACCTTATAACCCTTACGGG
CGACTGTGA
Transcript >Pro_DTO070G2_2|g1027.t1
ATGCGACTGCCTACAAGGCCCGAAGTCGTGATTTTGCTAGGCCATTTATTTCACTCTATTGCCCTTGCGTCTGCC
GTGTCCGACTCGACTACTACGAGCATTTTCAATCTGCCTCTTAGCCAGAACCAGGCCAATTTCATTTTTGCTATC
AACATCCCCGATGGCTCCACCGATCTCTACTTCCACATGTCTGGGCCGACGGACTATTCATGGATTGCGGTCGGG
ACTGGAAATGAAATGAAAGACTCTCTCATGTTTGTGATCTACTCCAAGGCCAATGGGGAAAATATTACCTTCAGC
CCTCGTCTCTCCTCCGGTGAACAAGAACCTGTGTATTCATCTTCGATCAAGGTGGACATTCTCAATGGTACAGGT
ATCTCCGATAACGTCATGACCGTGAATGCTAGGTGCTCAAACTGCACCCAGTGGGAGACTGGATCATTGGATTTG
AAATCCACGTCTCAGCCGTGGATTTTTGGGCTAGGTCCAACTGGTAGTTCGGCTGCCATGCTACGCAGTAACTCT
CAAACGGCAAACATAGAGAGACACTCAGAATATGGCATCTTCACTATGGATATGGTCCGCGCAACCGGCGGTTCG
GGTGGACTACCAACGTCGTATACAAACTCAACTGGCTCGGTGCTGAGCAAATCAATTACAAACGACAGCAACTGG
CCTAGCATCATTCACGGTCTGTGCCTTTGTGGAGCTCTCATCCTTCTGATGCCAGCCGGCGTCGTTCTCCTCCGT
GTTGCTCCGAAAAGTGTCCGGTGGCACTGGATCAACCAGACACTTTCTTCAGCAATTGCGATCGTCGGCATAATA
ATCGGCTTTTACCTAAGCACGATGTTCACAAAATCGCAAAACTACGGCTCCGCGCACCAGATCCTTGGTATTATC
CTTCTGCTTGCAATGCTAGCTCAGTGGGGAATGGGATTTTGGCATCACCGGGTATATAAACAGACTAAGTCACCT
ACCAGGTTTGGCATTATCCATCGCTACTTTGGACATATCATCATCTTCCTCGCGATCGTCAACGGAGGCATCGGA
CTTACTTGGTCATCTGCGTCCAAGTCCGTTGTAATAGGATATTCCATCGCTGTGATCATTATTGGGCTTGGGCTT
GTGCTTATCATTGGTTGGGCAAGGTGGATATCCAGACATGGCCAACAGGGTTTTACAAGTGCGCCTGTCAATCTC
CGAGGACTTAGTGGTGATGATTCCCACGATTACCTTGATCAGCACTCGGACATACTACCTTATAACCCTTACGGG
CGACTGTGA
Gene >Pro_DTO070G2_2|g1027.t1
ATGCGACTGCCTACAAGGCCCGAAGTCGTGATTTTGCTAGGTCGGTCAGGTCCCGATGCTTAGCCATTTTGGTAT
TGCTTCACATGTTATCTAACAGAATCACTGGCTCTTAACAGGCCATTTATTTCACTCTATTGCCCTTGCGTCTGC
CGTGTCCGACTCGACTACTACGAGCATTTTCAATCTGCCTCTTAGCCAGAACCAGGCCAATTTCATTTTTGCTAT
CAACATCCCCGATGGCTCCACCGATCTCTACTTCCACATGTCTGGGCCGACGGACTATTCATGGATTGCGGTCGG
GACTGGAAATGAAATGAAAGACTCTCTCATGTTTGTGATCTACTCCAAGGCCAATGGGGAAAGTGAGTTGACGTG
ACCCAAATACCTCTGAGAAGACAATCCTGACGCGCCTGTTTAGATATTACCTTCAGCCCTCGTCTCTCCTCCGGT
GAACAAGAACCTGTGTATTCATCTTCGATCAAGGTGGACATTCTCAATGGTACAGGTATCTCCGATAACGTCATG
ACCGTGAATGCTAGGTGCTCAAACTGCACCCAGTGGGAGACTGGATCATTGGATTTGAAATCCACGTCTCAGCCG
TGGATTTTTGGGCTAGGTCCAACTGGTAGTTCGGCTGCCATGCTACGCAGTAACTCTCAAACGGCAAACATAGAG
AGACACTCAGAATATGGTTCGTGATATCTTACTTGAACGGTATTTACTCGGGCTCCTGGACACTAATTTGTTTTG
ACATCCTAGGCATCTTCACTATGGATATGGTCCGCGCAACCGGCGGTTCGGGTGGACTACCAACGTCGTATACAA
ACTCAACTGGCTCGGTGCTGAGCAAATCAATTACAAACGACAGCAACTGGCCTAGCATCATTCACGGTCTGTGCC
TTTGTGGAGCTCTCATCCTTCTGATGCCAGCCGGCGTCGTTCTCCTCCGTGTTGCTCCGAAAAGTGTCCGGTGGC
ACTGGATCAACCAGACACTTTCTTCAGCAATTGCGATCGTCGGCATAATAATCGGCTTTTACCTAAGCACGATGT
TCACAAAATCGCAAAACTACGGCTCCGCGCACCAGATCCTTGGTATTATCCTTCTGCTTGCAATGCTAGCTCAGT
GGGGAATGGGATTTTGGCATCACCGGGTATATAAACAGACTAAGTCACCTACCAGGTTTGGCATTATCCATCGCT
ACTTTGGACATATCATCATCTTCCTCGCGATCGTCAACGGAGGCATCGGACTTACTTGGTCATCTGCGTCCAAGT
CCGTTGTAATAGGATATTCCATCGCTGTGATCATTATTGGGCTTGGGCTTGTGCTTATCATTGGTTGGGCAAGGT
GGATATCCAGACATGGCCAACAGGGTTTTACAAGTGCGCCTGTCAATCTCCGAGGACTTAGTGGTGATGATTCCC
ACGATTACCTTGATCAGCACTCGGACATACTACCTTATAACCCTTACGGGCGACTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail