Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO046C5_2|g614.t1
Gene name
Locationscaffold_001:1610599..1615714
Strand+
Gene length (bp)5115
Transcript length (bp)4803
Coding sequence length (bp)4803
Protein length (aa) 1601

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01369 Sec7 Sec7 domain 5.7E-62 630 814
PF12783 Sec7_N Guanine nucleotide exchange factor in Golgi transport N-terminal 3.0E-18 368 563

GO

GO Term Description Terminal node
GO:0032012 regulation of ARF protein signal transduction Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0050789 regulation of biological process No
GO:0003674 molecular_function No
GO:0046578 regulation of Ras protein signal transduction No
GO:0009966 regulation of signal transduction No
GO:0008150 biological_process No
GO:0030695 GTPase regulator activity No
GO:0048583 regulation of response to stimulus No
GO:0051056 regulation of small GTPase mediated signal transduction No
GO:0030234 enzyme regulator activity No
GO:0065007 biological regulation No
GO:0023051 regulation of signaling No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:1902531 regulation of intracellular signal transduction No
GO:0010646 regulation of cell communication No
GO:0050794 regulation of cellular process No
GO:0098772 molecular function regulator activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup8326
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g908.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g5129.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g615.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g3625.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g615.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g1096.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g1085.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g1113.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g4189.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g94.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g34.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g663.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g529.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g3233.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g3765.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g597.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g302.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g614.t1 (this protein)
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g1455.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g1514.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g301.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g3259.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g3736.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g1635.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g1618.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g1675.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g302.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g346.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g597.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g816.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g2266.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g3563.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g1265.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g147.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO046C5_2|g614.t1
MVSQQRASFVMLDPTMDSSSLPIAIDPVALVTTECITVTSSMRKHARWAHSSVSAILGGNGASRVYERDNSAPSS
PIPRRTGQPSPRPDEDHVLANRWGLRGKKGKSMQDNPLISAFTRLRSDLKDCKDIRTFDTPALLHPFLQVVRSSS
TSAAITSIALVSITKFLSYNIINPNSPRLSVAMQLLSAAITHCRFEASDSSADEIVLLRILKLMEGILSRPEGEL
LGDESVCEMMETGLSMCCQGRLSEVLRRSAEMAMVKMCQVIFMRLSHLDQGVPAGPDPFAGEDTKKDPPSRLKMD
PSVNGDTVTSQHLSAISADTSAAERHSTSREGSPEQAGNGIAAATAPPSPHDDPETELQPYSLPSIKELFRVLID
LLDPHNRQHTDAMRVMALRIIDVALEVAGPSIARHPSLAALAKDDLCRYLFQLVRSEHIAILTGSLRVAGTLLST
CRPVLKLQQELYLSYLVACLHPRVEIPREPGIDPSLYEGIPESPKLVKQPASQPNSGRATPVPVRDRQRLGLEGG
SRRPEAREAMVESIGMLSRIPSFMVELFVNYDCDVDRADLCEDMIGLLSRNAFPDSATWSTTNVPPLCLDSLLGY
VQFIHDRLDNEPIQGDYPPQESLKKQRHTKKLIIKGAQMFNEDPKKGIAFLVSHGVIEDANNPVLVARFLKGTTR
LSKKVLGEYISKRGNEELLGAFVDLLDFEGRSAVEALRELLSSFRLPGESPLIERIVTIFSEHYIEKVKPDGIAD
KDALYILTYAIIMLNTDLYNRNVKSQNRMTCAGFARNLRGVNGGGDFAEEFLEDIYDSIKNNEIILPDEHENKHA
FDYAWKELLLKSSSAGDVIVGETNMYDAEMFAATWKPVIATLSYVFMSASDDAVYSRVVNGFDQCAQIAARYGLT
EAFDRIVFSLASISTLGTSKPPSTALNTEVQVGQKSVMVSELAVKFGRDFRAQLATVVLFRVLSTNESTVNQGWE
YIVRILSNLFINSLIPPFDAKLTSELEISPIPLQPPSQVIDRDGRNNDTGILSAFTSYLSSYAADDPPEPSDEEL
DNTLCTVDCVTACSISEILTNIKSLPLSSLEMLVEALLSLLPEENAPAVIVVKPERPTPTSRVANSRADPNQPKY
DPSMIFVLELATVLTLRDEKTLEVLGENLATTLQTLVRDAKNLHPLTVSRVVSYLLNLLRLSHDQHFIRVPVVLH
AISGFDQDILETVAVATVKGLARCIAHTGRLRNEITISPDFWSILQRLHQHEAVASLVFDLLQSIVESMPDIITA
DNYEFVVSLANDFVSAGRVGSIEERHRDAQARRNKGVKQSKSSENQVVTRGIKAIGLIYHLTGRVPALIKQSHLE
ENEAWAAYWSPIFQSLTSQCINPCRDIRHHAISTLQRSLLSAELISSDDQEWTSIFDEVLFPLVLLLLKPEVYHS
DPVGMSETRFQAATLVCKIFLRFLDQLPNRTGMLPLWLRILDILDRMMNSGQGDSLAEAVPESLKNILLVMADGG
YLVSPSQDPSKEEIWVETRKRLGRFLPDLFLEIFPDVANEPETPAPRSAVSSPEQSHETEKATETEQTSEDIASQ
QDGEEGKEDANTESHIPQEAEESTS*
Coding >Pro_DTO046C5_2|g614.t1
ATGGTGTCACAACAGCGAGCATCTTTTGTGATGCTCGATCCCACTATGGACTCGTCTTCTCTTCCAATTGCCATA
GACCCGGTGGCTTTGGTGACCACTGAATGTATCACCGTCACCTCGTCTATGCGCAAGCATGCACGCTGGGCTCAC
TCCTCAGTCTCCGCCATCCTGGGCGGCAATGGAGCCTCTCGTGTTTATGAGCGGGATAACTCTGCCCCCTCAAGT
CCAATTCCACGCAGGACTGGTCAACCGTCACCTCGTCCCGATGAAGATCATGTCCTGGCTAATCGGTGGGGTCTG
CGAGGGAAGAAGGGGAAGAGCATGCAGGACAACCCATTAATATCGGCCTTTACACGACTGCGGAGTGATCTGAAA
GATTGCAAAGATATCCGAACTTTTGATACCCCAGCGTTACTTCATCCATTCCTACAGGTCGTTCGCTCCTCTTCG
ACCTCCGCCGCAATTACCTCTATCGCCTTGGTCTCCATTACCAAGTTCCTCTCGTACAATATTATCAACCCGAAT
TCCCCACGGCTCTCTGTAGCTATGCAGCTACTATCAGCCGCGATCACACACTGCCGATTTGAGGCCAGCGACTCG
TCGGCGGACGAGATAGTCCTTTTGAGGATTCTGAAGTTGATGGAGGGCATACTTTCACGACCTGAAGGCGAGCTT
TTGGGCGACGAGAGCGTCTGTGAGATGATGGAAACTGGTTTGAGCATGTGCTGCCAGGGTCGTCTGTCAGAGGTA
CTACGGAGATCCGCCGAAATGGCAATGGTCAAAATGTGCCAGGTGATCTTCATGCGTCTATCGCATCTTGATCAA
GGAGTGCCCGCAGGACCGGATCCATTTGCGGGCGAAGATACAAAAAAGGACCCACCCTCTCGTCTGAAGATGGAC
CCGTCGGTTAATGGAGACACCGTGACTTCGCAGCACCTGTCAGCCATCAGCGCAGACACATCGGCCGCAGAACGT
CATAGTACTAGTCGAGAGGGATCACCCGAGCAGGCAGGAAATGGTATCGCAGCAGCTACTGCACCACCTAGCCCG
CATGATGATCCCGAAACCGAGCTTCAGCCCTACTCCTTACCATCCATCAAAGAATTATTCCGTGTCTTGATCGAC
CTGTTGGACCCTCATAACCGGCAACATACAGACGCCATGCGTGTGATGGCACTCCGAATTATTGATGTTGCCTTG
GAAGTAGCAGGTCCTTCCATTGCTCGGCATCCCAGTCTGGCTGCCCTGGCTAAGGACGATCTTTGTCGATACCTC
TTTCAGCTAGTCAGGTCAGAACACATAGCTATTCTAACTGGTTCGTTGAGAGTAGCTGGCACCTTGTTATCAACC
TGCCGGCCAGTTTTGAAATTACAGCAGGAACTCTATCTTTCATATTTAGTGGCCTGCTTGCACCCTCGCGTGGAA
ATACCGCGAGAACCTGGCATCGACCCATCGCTCTACGAAGGAATTCCTGAATCACCAAAGTTGGTGAAGCAGCCA
GCTTCGCAGCCCAATAGCGGACGAGCCACACCTGTTCCTGTTAGAGATCGACAGAGATTGGGGCTCGAAGGAGGA
TCAAGAAGGCCCGAAGCTCGAGAGGCAATGGTAGAGAGCATTGGCATGTTGTCACGCATACCTAGCTTTATGGTT
GAGCTTTTTGTCAACTATGATTGTGACGTGGACCGAGCCGACCTGTGCGAGGATATGATTGGATTGCTCTCTCGC
AATGCTTTCCCAGACTCTGCAACTTGGAGCACTACAAATGTACCCCCGTTATGTCTCGATTCCCTTTTGGGCTAT
GTGCAGTTCATCCATGATCGGCTGGATAACGAGCCTATACAAGGAGATTATCCTCCTCAAGAAAGCTTGAAAAAA
CAACGCCACACGAAGAAACTCATTATCAAGGGGGCACAGATGTTCAATGAGGATCCTAAGAAGGGAATTGCCTTC
CTTGTGAGCCATGGTGTTATTGAGGACGCGAATAATCCCGTTCTGGTTGCTCGCTTCTTGAAGGGCACCACACGC
CTGTCAAAGAAAGTCCTCGGAGAATACATCTCCAAACGCGGCAACGAGGAGTTGCTAGGCGCATTTGTGGATCTC
CTTGACTTCGAGGGACGTAGTGCAGTGGAAGCTCTTCGGGAACTACTCAGTTCATTCCGTTTGCCTGGTGAATCG
CCGCTCATTGAGCGAATTGTGACGATCTTTTCGGAACATTACATTGAAAAGGTCAAGCCGGATGGCATCGCCGAT
AAAGACGCACTATACATTTTGACCTACGCCATCATCATGCTGAACACCGATCTCTACAACCGCAACGTGAAGTCA
CAAAACCGTATGACTTGCGCTGGCTTTGCAAGGAACTTGCGAGGCGTCAACGGGGGTGGAGACTTCGCGGAGGAA
TTCCTCGAGGATATCTATGACTCTATCAAGAATAACGAAATCATTCTACCCGATGAACACGAAAACAAGCATGCA
TTTGACTATGCTTGGAAGGAACTATTGCTGAAGTCTTCATCTGCCGGCGACGTCATAGTGGGAGAGACCAACATG
TATGATGCCGAAATGTTCGCGGCTACGTGGAAACCAGTGATTGCGACCCTCTCATATGTCTTCATGTCTGCATCA
GATGATGCAGTATATTCCCGCGTGGTCAATGGTTTCGACCAGTGTGCCCAGATTGCTGCCCGCTATGGCTTGACG
GAGGCGTTCGACCGTATCGTCTTCTCCCTTGCATCGATTAGCACTTTGGGTACTAGCAAACCTCCTAGTACAGCG
CTCAACACAGAGGTTCAGGTTGGTCAGAAGAGTGTGATGGTAAGCGAGCTAGCCGTCAAATTTGGCCGAGACTTC
AGAGCACAACTGGCAACTGTGGTGCTTTTCCGAGTCCTCTCAACAAATGAGTCAACTGTCAACCAAGGCTGGGAG
TATATCGTCCGCATATTGAGTAACTTGTTCATCAACTCTCTCATCCCGCCGTTTGACGCTAAACTCACGTCCGAA
CTTGAAATATCTCCAATTCCGCTACAGCCTCCATCACAGGTGATTGATCGGGATGGACGCAACAACGACACGGGA
ATTTTGTCTGCATTCACATCTTACCTCTCAAGTTATGCGGCAGACGATCCTCCTGAGCCTTCGGACGAAGAACTT
GACAACACACTCTGCACAGTGGATTGTGTGACTGCCTGCTCAATATCCGAAATTTTGACAAATATTAAATCTCTT
CCTCTGTCCTCATTGGAAATGCTCGTGGAGGCTTTGCTGTCGTTGCTTCCCGAGGAGAACGCACCAGCAGTCATT
GTCGTAAAACCCGAACGCCCGACACCAACGTCGAGGGTTGCCAACAGCAGAGCTGACCCTAACCAACCTAAATAC
GATCCTTCGATGATATTCGTTCTAGAGTTGGCGACGGTGCTCACTCTTCGTGACGAAAAGACCCTGGAGGTTCTC
GGTGAAAACCTGGCAACAACTCTTCAAACACTGGTGCGCGATGCGAAGAATCTCCATCCGCTAACCGTGTCTCGT
GTTGTTTCTTACCTCCTAAATCTCTTGCGGCTGAGCCATGACCAACACTTTATCCGGGTACCCGTTGTGCTCCAC
GCTATTTCTGGATTCGACCAGGATATTTTGGAAACCGTGGCCGTGGCGACGGTCAAGGGTCTTGCCAGGTGCATT
GCTCATACAGGCCGTCTAAGAAACGAGATCACTATTTCTCCGGATTTCTGGTCGATCTTGCAAAGACTCCATCAA
CACGAGGCAGTCGCTTCTCTTGTCTTTGATCTTCTACAAAGCATTGTTGAGTCAATGCCCGATATTATCACAGCC
GACAACTATGAGTTCGTAGTCAGCCTGGCCAATGACTTCGTCAGCGCCGGGCGTGTGGGTTCTATCGAGGAACGA
CACCGGGATGCTCAGGCCCGTCGGAATAAGGGGGTCAAACAATCCAAGTCAAGTGAGAACCAAGTTGTGACTCGC
GGCATCAAGGCAATCGGTCTGATCTATCATCTGACTGGACGAGTCCCGGCTCTTATCAAACAATCTCATCTTGAG
GAGAATGAAGCCTGGGCTGCCTACTGGTCGCCTATCTTCCAGTCCTTGACCAGTCAATGCATCAACCCGTGTCGC
GATATCCGACACCATGCTATTTCCACGCTGCAGCGATCTCTTCTATCTGCCGAACTGATCTCAAGCGATGACCAG
GAGTGGACTAGCATCTTCGATGAAGTCCTATTCCCGCTCGTCCTACTTCTTTTGAAGCCGGAGGTCTACCACTCC
GACCCTGTTGGTATGAGCGAGACCCGATTCCAAGCCGCAACATTGGTCTGCAAGATCTTCCTGCGCTTCCTCGAT
CAGCTCCCCAACCGGACGGGTATGCTCCCTCTCTGGCTCAGGATCCTGGACATCCTTGATCGCATGATGAACAGT
GGTCAGGGCGATAGTCTGGCAGAAGCAGTCCCCGAAAGCTTGAAGAATATCCTCCTAGTAATGGCTGATGGAGGC
TACCTTGTGTCCCCATCCCAAGACCCAAGCAAGGAGGAAATATGGGTCGAGACTCGCAAACGCCTTGGCCGCTTC
TTGCCCGATCTCTTCTTGGAGATCTTCCCCGATGTTGCGAACGAGCCTGAAACGCCTGCTCCGCGCTCTGCCGTC
TCATCCCCAGAGCAGTCCCATGAGACAGAGAAGGCTACTGAGACAGAGCAGACGAGCGAAGATATTGCGTCCCAG
CAGGACGGCGAAGAAGGAAAGGAGGATGCTAATACCGAGAGCCACATTCCTCAGGAGGCAGAGGAAAGTACCTCC
TAA
Transcript >Pro_DTO046C5_2|g614.t1
ATGGTGTCACAACAGCGAGCATCTTTTGTGATGCTCGATCCCACTATGGACTCGTCTTCTCTTCCAATTGCCATA
GACCCGGTGGCTTTGGTGACCACTGAATGTATCACCGTCACCTCGTCTATGCGCAAGCATGCACGCTGGGCTCAC
TCCTCAGTCTCCGCCATCCTGGGCGGCAATGGAGCCTCTCGTGTTTATGAGCGGGATAACTCTGCCCCCTCAAGT
CCAATTCCACGCAGGACTGGTCAACCGTCACCTCGTCCCGATGAAGATCATGTCCTGGCTAATCGGTGGGGTCTG
CGAGGGAAGAAGGGGAAGAGCATGCAGGACAACCCATTAATATCGGCCTTTACACGACTGCGGAGTGATCTGAAA
GATTGCAAAGATATCCGAACTTTTGATACCCCAGCGTTACTTCATCCATTCCTACAGGTCGTTCGCTCCTCTTCG
ACCTCCGCCGCAATTACCTCTATCGCCTTGGTCTCCATTACCAAGTTCCTCTCGTACAATATTATCAACCCGAAT
TCCCCACGGCTCTCTGTAGCTATGCAGCTACTATCAGCCGCGATCACACACTGCCGATTTGAGGCCAGCGACTCG
TCGGCGGACGAGATAGTCCTTTTGAGGATTCTGAAGTTGATGGAGGGCATACTTTCACGACCTGAAGGCGAGCTT
TTGGGCGACGAGAGCGTCTGTGAGATGATGGAAACTGGTTTGAGCATGTGCTGCCAGGGTCGTCTGTCAGAGGTA
CTACGGAGATCCGCCGAAATGGCAATGGTCAAAATGTGCCAGGTGATCTTCATGCGTCTATCGCATCTTGATCAA
GGAGTGCCCGCAGGACCGGATCCATTTGCGGGCGAAGATACAAAAAAGGACCCACCCTCTCGTCTGAAGATGGAC
CCGTCGGTTAATGGAGACACCGTGACTTCGCAGCACCTGTCAGCCATCAGCGCAGACACATCGGCCGCAGAACGT
CATAGTACTAGTCGAGAGGGATCACCCGAGCAGGCAGGAAATGGTATCGCAGCAGCTACTGCACCACCTAGCCCG
CATGATGATCCCGAAACCGAGCTTCAGCCCTACTCCTTACCATCCATCAAAGAATTATTCCGTGTCTTGATCGAC
CTGTTGGACCCTCATAACCGGCAACATACAGACGCCATGCGTGTGATGGCACTCCGAATTATTGATGTTGCCTTG
GAAGTAGCAGGTCCTTCCATTGCTCGGCATCCCAGTCTGGCTGCCCTGGCTAAGGACGATCTTTGTCGATACCTC
TTTCAGCTAGTCAGGTCAGAACACATAGCTATTCTAACTGGTTCGTTGAGAGTAGCTGGCACCTTGTTATCAACC
TGCCGGCCAGTTTTGAAATTACAGCAGGAACTCTATCTTTCATATTTAGTGGCCTGCTTGCACCCTCGCGTGGAA
ATACCGCGAGAACCTGGCATCGACCCATCGCTCTACGAAGGAATTCCTGAATCACCAAAGTTGGTGAAGCAGCCA
GCTTCGCAGCCCAATAGCGGACGAGCCACACCTGTTCCTGTTAGAGATCGACAGAGATTGGGGCTCGAAGGAGGA
TCAAGAAGGCCCGAAGCTCGAGAGGCAATGGTAGAGAGCATTGGCATGTTGTCACGCATACCTAGCTTTATGGTT
GAGCTTTTTGTCAACTATGATTGTGACGTGGACCGAGCCGACCTGTGCGAGGATATGATTGGATTGCTCTCTCGC
AATGCTTTCCCAGACTCTGCAACTTGGAGCACTACAAATGTACCCCCGTTATGTCTCGATTCCCTTTTGGGCTAT
GTGCAGTTCATCCATGATCGGCTGGATAACGAGCCTATACAAGGAGATTATCCTCCTCAAGAAAGCTTGAAAAAA
CAACGCCACACGAAGAAACTCATTATCAAGGGGGCACAGATGTTCAATGAGGATCCTAAGAAGGGAATTGCCTTC
CTTGTGAGCCATGGTGTTATTGAGGACGCGAATAATCCCGTTCTGGTTGCTCGCTTCTTGAAGGGCACCACACGC
CTGTCAAAGAAAGTCCTCGGAGAATACATCTCCAAACGCGGCAACGAGGAGTTGCTAGGCGCATTTGTGGATCTC
CTTGACTTCGAGGGACGTAGTGCAGTGGAAGCTCTTCGGGAACTACTCAGTTCATTCCGTTTGCCTGGTGAATCG
CCGCTCATTGAGCGAATTGTGACGATCTTTTCGGAACATTACATTGAAAAGGTCAAGCCGGATGGCATCGCCGAT
AAAGACGCACTATACATTTTGACCTACGCCATCATCATGCTGAACACCGATCTCTACAACCGCAACGTGAAGTCA
CAAAACCGTATGACTTGCGCTGGCTTTGCAAGGAACTTGCGAGGCGTCAACGGGGGTGGAGACTTCGCGGAGGAA
TTCCTCGAGGATATCTATGACTCTATCAAGAATAACGAAATCATTCTACCCGATGAACACGAAAACAAGCATGCA
TTTGACTATGCTTGGAAGGAACTATTGCTGAAGTCTTCATCTGCCGGCGACGTCATAGTGGGAGAGACCAACATG
TATGATGCCGAAATGTTCGCGGCTACGTGGAAACCAGTGATTGCGACCCTCTCATATGTCTTCATGTCTGCATCA
GATGATGCAGTATATTCCCGCGTGGTCAATGGTTTCGACCAGTGTGCCCAGATTGCTGCCCGCTATGGCTTGACG
GAGGCGTTCGACCGTATCGTCTTCTCCCTTGCATCGATTAGCACTTTGGGTACTAGCAAACCTCCTAGTACAGCG
CTCAACACAGAGGTTCAGGTTGGTCAGAAGAGTGTGATGGTAAGCGAGCTAGCCGTCAAATTTGGCCGAGACTTC
AGAGCACAACTGGCAACTGTGGTGCTTTTCCGAGTCCTCTCAACAAATGAGTCAACTGTCAACCAAGGCTGGGAG
TATATCGTCCGCATATTGAGTAACTTGTTCATCAACTCTCTCATCCCGCCGTTTGACGCTAAACTCACGTCCGAA
CTTGAAATATCTCCAATTCCGCTACAGCCTCCATCACAGGTGATTGATCGGGATGGACGCAACAACGACACGGGA
ATTTTGTCTGCATTCACATCTTACCTCTCAAGTTATGCGGCAGACGATCCTCCTGAGCCTTCGGACGAAGAACTT
GACAACACACTCTGCACAGTGGATTGTGTGACTGCCTGCTCAATATCCGAAATTTTGACAAATATTAAATCTCTT
CCTCTGTCCTCATTGGAAATGCTCGTGGAGGCTTTGCTGTCGTTGCTTCCCGAGGAGAACGCACCAGCAGTCATT
GTCGTAAAACCCGAACGCCCGACACCAACGTCGAGGGTTGCCAACAGCAGAGCTGACCCTAACCAACCTAAATAC
GATCCTTCGATGATATTCGTTCTAGAGTTGGCGACGGTGCTCACTCTTCGTGACGAAAAGACCCTGGAGGTTCTC
GGTGAAAACCTGGCAACAACTCTTCAAACACTGGTGCGCGATGCGAAGAATCTCCATCCGCTAACCGTGTCTCGT
GTTGTTTCTTACCTCCTAAATCTCTTGCGGCTGAGCCATGACCAACACTTTATCCGGGTACCCGTTGTGCTCCAC
GCTATTTCTGGATTCGACCAGGATATTTTGGAAACCGTGGCCGTGGCGACGGTCAAGGGTCTTGCCAGGTGCATT
GCTCATACAGGCCGTCTAAGAAACGAGATCACTATTTCTCCGGATTTCTGGTCGATCTTGCAAAGACTCCATCAA
CACGAGGCAGTCGCTTCTCTTGTCTTTGATCTTCTACAAAGCATTGTTGAGTCAATGCCCGATATTATCACAGCC
GACAACTATGAGTTCGTAGTCAGCCTGGCCAATGACTTCGTCAGCGCCGGGCGTGTGGGTTCTATCGAGGAACGA
CACCGGGATGCTCAGGCCCGTCGGAATAAGGGGGTCAAACAATCCAAGTCAAGTGAGAACCAAGTTGTGACTCGC
GGCATCAAGGCAATCGGTCTGATCTATCATCTGACTGGACGAGTCCCGGCTCTTATCAAACAATCTCATCTTGAG
GAGAATGAAGCCTGGGCTGCCTACTGGTCGCCTATCTTCCAGTCCTTGACCAGTCAATGCATCAACCCGTGTCGC
GATATCCGACACCATGCTATTTCCACGCTGCAGCGATCTCTTCTATCTGCCGAACTGATCTCAAGCGATGACCAG
GAGTGGACTAGCATCTTCGATGAAGTCCTATTCCCGCTCGTCCTACTTCTTTTGAAGCCGGAGGTCTACCACTCC
GACCCTGTTGGTATGAGCGAGACCCGATTCCAAGCCGCAACATTGGTCTGCAAGATCTTCCTGCGCTTCCTCGAT
CAGCTCCCCAACCGGACGGGTATGCTCCCTCTCTGGCTCAGGATCCTGGACATCCTTGATCGCATGATGAACAGT
GGTCAGGGCGATAGTCTGGCAGAAGCAGTCCCCGAAAGCTTGAAGAATATCCTCCTAGTAATGGCTGATGGAGGC
TACCTTGTGTCCCCATCCCAAGACCCAAGCAAGGAGGAAATATGGGTCGAGACTCGCAAACGCCTTGGCCGCTTC
TTGCCCGATCTCTTCTTGGAGATCTTCCCCGATGTTGCGAACGAGCCTGAAACGCCTGCTCCGCGCTCTGCCGTC
TCATCCCCAGAGCAGTCCCATGAGACAGAGAAGGCTACTGAGACAGAGCAGACGAGCGAAGATATTGCGTCCCAG
CAGGACGGCGAAGAAGGAAAGGAGGATGCTAATACCGAGAGCCACATTCCTCAGGAGGCAGAGGAAAGTACCTCC
TAA
Gene >Pro_DTO046C5_2|g614.t1
ATGGTGTCACAACAGCGAGCATCTTTTGTGATGCTCGATCCCACTATGGACTCGTCTTCTCTTCCAATTGCCATA
GACCCGGTGGCTTTGGTGACCACTGAATGTATCACCGTCACCTCGTCTATGCGCAAGCATGCACGCTGGGCTCAC
TCCTCAGTCTCCGCCATCCTGGGCGGCAATGGAGCCTCTCGTGTTTATGAGCGGGATAACTCTGCCCCCTCAAGT
CCAATTCCACGCAGGACTGGTCAACCGTCACCTCGTCCCGATGAAGATCATGTCCTGGCTAATCGGTGGGGTCTG
CGAGGGAAGAAGGGGAAGAGCATGCAGGACAACCCATTAATATCGGCCTTTACACGACTGCGGAGTGATCTGAAA
GATTGCAAAGATATCCGAACTTTTGATACCCCAGCGTTACTTCATCCATTCCTACAGGTCGTTCGCTCCTCTTCG
ACCTCCGCCGCAATTACCTCTATCGCCTTGGTCTCCATTACCAAGTTCCTCTCGTACAATATTATCAACCCGAAT
TCCCCACGGCTCTCTGTAGCTATGCAGCTACTATCAGCCGCGATCACACACTGCCGATTTGAGGCCAGCGACTCG
TCGGCGGACGAGATAGTCCTTTTGAGGATTCTGAAGTTGATGGAGGGCATACTTTCACGACCTGAAGGCGAGCTT
TTGGGCGACGAGAGCGTCTGTGAGATGATGGAAACTGGTTTGAGCATGTGCTGCCAGGGTCGTCTGTCAGAGGTA
CTACGGAGATCCGCCGAAATGGCAATGGTCAAAATGTGCCAGGTGATCTTCATGCGTCTATCGCATCTTGATCAA
GGAGTGCCCGCAGGACCGGATCCATTTGCGGGCGAAGATACAAAAAAGGACCCACCCTCTCGTCTGAAGATGGAC
CCGTCGGTTAATGGAGACACCGTGACTTCGCAGCACCTGTCAGCCATCAGCGCAGACACATCGGCCGCAGAACGT
CATAGTACTAGTCGAGAGGGATCACCCGAGCAGGCAGGAAATGGTATCGCAGCAGCTACTGCACCACCTAGCCCG
CATGATGATCCCGAAACCGAGCTTCAGCCCTACTCCTTACCATCCATCAAAGAATTATTCCGTGTCTTGATCGAC
CTGTTGGACCCTCATAACCGGCAACATACAGACGCCATGCGTGTGATGGCACTCCGAATTATTGATGTTGCCTTG
GAAGTAGCAGGTCCTTCCATTGCTCGGCATCCCAGTCTGGCTGCCCTGGCTAAGGACGATCTTTGTCGATACCTC
TTTCAGCTAGTCAGGTCAGAACACATAGCTATTCTAACTGGTTCGTTGAGAGTAGCTGGCACCTTGTTATCAACC
TGCCGGCCAGTTTTGAAATTACAGCAGGAACTCTATCTTTCATATTTAGTGGCCTGCTTGCACCCTCGCGTGGAA
ATACCGCGAGAACCTGGCATCGACCCATCGCTCTACGAAGGAATTCCTGAATCACCAAAGTTGGTGAAGCAGCCA
GCTTCGCAGCCCAATAGCGGACGAGCCACACCTGTTCCTGTTAGAGATCGACAGAGATTGGGGCTCGAAGGAGGA
TCAAGAAGGCCCGAAGCTCGAGAGGCAATGGTAGAGAGCATTGGCATGTTGTCACGCATACCTAGCTTTATGGTT
GAGCTTTTTGTCAACTATGATTGTGACGTGGACCGAGCCGACCTGTGCGAGGATATGATTGGATTGCTCTCTCGC
AATGCTTTCCCAGACTCTGCAACTTGGAGCACTACAAATGTACCCCCGTTATGTCTCGATTCCCTTTTGGGCTAT
GTGCAGTTCATCCATGATCGGCTGGATAACGAGCCTATACAAGGAGATTATCCTCCTCAAGAAAGCTTGAAAAAA
CAACGCCACACGAAGAAACTCATTATCAAGGGGGCACAGATGTTCAATGAGGATCCTAAGAAGGGAATTGCCTTC
CTTGTGAGCCATGGTGTTATTGAGGACGCGAATAATCCCGTTCTGGTTGCTCGCTTCTTGAAGGGCACCACACGC
CTGTCAAAGAAAGTCCTCGGAGAATACATCTCCAAACGCGGCAACGAGGAGTTGCTAGGCGCATTTGTGGATCTC
CTTGACTTCGAGGGACGTAGTGCAGTGGAAGCTCTTCGGGAACTACTCAGTTCATTCCGTTTGCCTGGTGAATCG
CCGCTCATTGAGCGAATTGTGACGATCTTTTCGGAACATTACATTGAAAAGGTCAAGCCGGATGGCATCGCCGAT
AAAGACGCACTATACATTTTGACCTACGCCATCATCATGCTGAACACCGATCTCTACAACCGCAACGTGAAGTCA
CAAAACCGTATGACTTGCGCTGGCTTTGCAAGGAACTTGCGAGGCGTCAACGGGGGTGGAGACTTCGCGGAGGAA
TTCCTCGAGGATATCTATGACTCTATCAAGAATAACGAAATCATTCTACCCGATGAACACGAAAACAAGCATGCA
TTTGACTATGCTTGGAAGGAACTATTGCTGAAGTCTTCATCTGCCGGCGACGTCATAGTGGGAGAGACCAACATG
TATGATGCCGAAATGTTCGCGGCTACGTGGAAACCAGTGATTGCGACCCTCTCATATGTCTTCATGTCTGCATCA
GATGATGCAGTATATTCCCGCGTGGTCAATGGTTTCGACCAGTGTGCCCAGATTGCTGCCCGCTATGGCTTGACG
GAGGCGTTCGACCGTATCGTCTTCTCCCTTGCATCGATTAGCACTTTGGGTACTAGCAAACCTCCTAGTACAGCG
CTCAACACAGAGGTTCAGGTTGGTCAGAAGAGTGTGATGGTAAGCGAGCTAGCCGTCAAATTTGGCCGAGACTTC
AGAGCACAACTGGCAACTGTGGTGCTTTTCCGAGTCCTCTCAACAAATGAGTCAACTGTCAACCAAGGCTGGGAG
TATATCGTCCGCATATTGAGTAACTTGTTCATCAACTCTCTCATCCCGCCGTTTGACGCTAAACTCACGTCCGAA
CTTGAAATATCTCCAATTCCGCTACAGCCTCCATCACAGGTGATTGATCGGGATGGACGCAACAACGACACGGGA
ATTTTGTCTGCATTCACATCTTACCTCTCAAGTTATGCGGCAGACGATCCTCCTGAGCCTTCGGACGAAGAACTT
GACAACACACTCTGCACAGTGGATTGTGTGACTGCCTGCTCAATATCCGAAATTTTGACAAATATTAAGTCAGTA
AAGATGTTTCATTGATGGGTTGTGGTCATGATACTGACTTCTTCCGCAGATCTCTTCCTCTGTCCTCATTGGAAA
TGCTCGTGGAGGCTTTGCTGTCGTTGCTTCCCGAGGAGAACGCACCAGCAGTCATTGTCGTAAAACCCGAACGCC
CGACACCAACGTCGAGGGTTGCCAACAGCAGAGCTGACCCTAACCAACCTAAATACGATCCTTCGATGATATTCG
TTCTAGAGTTGGCGACGGTGCTCACTCTTCGTGACGAAAAGACCCTGGAGGTTCTCGGTGAAAACCTGGCAACAA
CTCTTCAAACACTGGTGCGCGATGCGAAGAATCTCCATCCGCTAACCGTGTCTCGTGTTGTTTCTTACCTCCTAA
ATCTCTTGCGGCTGAGCCATGTATGTACTCTCCTTTACCCTGTGGCTTTGATGTAGGTTCTCCTTTACTGATCCC
ACGCTAGGACCAACACTTTATCCGGGTACCCGTTGTGCTCCACGCTATTTCTGGATTCGACCAGGATATTTTGGA
AACCGTGGCCGTGGCGACGGTCAAGGGTCTTGCCAGGTGCATTGCTCATACAGGCCGTCTAAGAAACGAGATCAC
TATTTCTCCGGATTTCTGGTCGATCTTGCAAAGACTCCATCAACACGAGGCAGTCGCTTCTCTTGTCTTTGATCT
TCTACAAAGCATTGTTGAGTCAATGCCCGATATTATCACAGCCGACAACTATGAGTTCGTAGTCAGCCTGGCCAA
TGACTTCGTCAGCGCCGGGCGTGTGGGTTCTATCGAGGAACGACACCGGGATGCTCAGGCCCGTCGGAATAAGGG
GGTCAAACAATCCAAGTCAAGGTAAGGGTACCATGCACCTCTGTCCATTGTTGATACTTACTTCTCCTTCCGTAG
TGAGAACCAAGTTGTGACTCGCGGCATCAAGGCAATCGGTCTGATCTATCATCTGACTGGACGAGTCCCGGCTCT
TATCAAACAATCTCATCTTGAGGAGAATGAAGGTAACGATCGATCCTCTGACATGTCTACTGCAACGAGTTTCTA
ATAGGTGCATTTCTAGCCTGGGCTGCCTACTGGTCGCCTATCTTCCAGTCCTTGACCAGTCAATGCATCAACCCG
TGTCGCGATATCCGACACCATGCTATTTCCACGCTGCAGCGATCTCTTCTATCTGCCGAACTGATCTCAAGCGAT
GACCAGGAGTGGACTAGCATCTTCGATGAAGTCCTATTCCCGCTCGTCCTACTTCTTTTGAAGCCGGAGGTCTAC
CACTCCGACCCTGTTGGTATGAGCGAGACCCGATTCCAAGCCGCAACATTGGTCTGCAAGATCTTCCTGCGCTTC
CTCGATCAGCTCCCCAACCGGACGGGTATGCTCCCTCTCTGGCTCAGGATCCTGGACATCCTTGATCGCATGATG
AACAGTGGTCAGGGCGATAGTCTGGTAAGTCGATTATTCTACCCGACGACCCAAGTATACCATGACCACTCCCAT
CTAACAAATTCTTTTTTCTCAATCTCGTAGGCAGAAGCAGTCCCCGAAAGCTTGAAGAATATCCTCCTAGTAATG
GCTGATGGAGGCTACCTTGTGTCCCCATCCCAAGACCCAAGCAAGGAGGAAATATGGGTCGAGACTCGCAAACGC
CTTGGCCGCTTCTTGCCCGATCTCTTCTTGGAGATCTTCCCCGATGTTGCGAACGAGCCTGAAACGCCTGCTCCG
CGCTCTGCCGTCTCATCCCCAGAGCAGTCCCATGAGACAGAGAAGGCTACTGAGACAGAGCAGACGAGCGAAGAT
ATTGCGTCCCAGCAGGACGGCGAAGAAGGAAAGGAGGATGCTAATACCGAGAGCCACATTCCTCAGGAGGCAGAG
GAAAGTACCTCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail