Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO039G3_2|g6586.t1
Gene name
Locationscaffold_11:328289..330205
Strand-
Gene length (bp)1916
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14324 PINIT PINIT domain 1.5E-40 135 271
PF02891 zf-MIZ MIZ/SP-RING zinc finger 6.4E-22 313 361
PF11789 zf-Nse Zinc-finger of the MIZ type in Nse subunit 1.2E-06 305 360

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, MIZ-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup8582
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g9337.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g7660.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g7402.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g4866.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g6268.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g8639.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g8836.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g9672.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g9541.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g7943.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g8102.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g7584.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g8188.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g9321.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g6679.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g9126.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g6586.t1 (this protein)
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g8943.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g8404.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g7639.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g6872.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g9850.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g8105.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g9062.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g8688.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g8618.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g9438.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g3700.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g9076.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g8455.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g8770.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g9386.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g9333.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g8996.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO039G3_2|g6586.t1
MSTSLSSEVATLTAFIKPLTNPQLKDLLRYEGLQVSGLKATLQFRIIQRIQSLAESDPVSFDALARRIRATAFPN
TVPYQSPARPQYQPPPVSQSPAQARSAPLGVSMSPHSYSGPSAPLMKPPAAAHKSPGPLIFKESPFYTILEPLTA
VVECKVREQTRDSVELKVMLSQQVAYRLQTDSNLRVMVYCAGDSGLTQYTKSDIAFPHQVELKVNLDEVKANLRG
LKNRPGTTQPADVTNWIRKKPNYPNNIVMTYALTQKKFFALANLVKQHPTDDLVSQLKTRKLISKEQVLREMRNR
ANDSDIVATSSVMSLKCPLSTLRIQVPCRSIVCTHNQCFDASSFLELQKQAPTWTCPVCSKSTSFESLQVDQYVD
DILQSTSPDTDQVIVEPDGVWSSPTDSDATKLGGMTPASDDDDDLIEISEPGMPVVKQEPGPTTVALERTPAQSQ
SREASTPSSAMRMSSKKRPIAQVIDLTESGDEDDESPLPPPKRPATSLPSRAFSRQDYHVPPASSPLNGGSYPP*
Coding >Pro_DTO039G3_2|g6586.t1
ATGTCGACCAGCCTGTCGTCAGAGGTCGCGACACTGACAGCCTTTATCAAGCCCCTTACAAATCCACAACTGAAA
GATTTGTTGAGGTATGAGGGCCTCCAGGTATCCGGGTTGAAGGCAACCCTACAGTTTCGCATTATCCAACGAATC
CAATCTCTCGCAGAATCTGACCCTGTCAGTTTCGATGCTCTAGCTCGGCGCATCCGTGCTACTGCTTTTCCAAAC
ACCGTGCCGTATCAATCACCCGCTAGACCACAATACCAGCCACCGCCTGTCTCTCAATCTCCTGCACAGGCTCGA
TCCGCGCCGCTCGGGGTTTCCATGTCACCTCACTCATACTCTGGTCCGAGTGCTCCTCTCATGAAACCTCCTGCG
GCCGCTCATAAATCTCCAGGTCCTTTGATTTTCAAAGAAAGTCCATTTTATACAATCCTAGAGCCTTTGACTGCA
GTCGTGGAATGTAAAGTACGCGAACAAACGCGGGATAGTGTTGAACTGAAGGTCATGCTATCTCAGCAAGTTGCC
TATAGGCTGCAAACGGACTCAAATCTTCGAGTGATGGTTTATTGCGCCGGTGATTCAGGTCTCACACAATACACC
AAGTCGGATATCGCATTTCCACATCAAGTGGAGCTCAAAGTCAATCTCGATGAAGTCAAAGCTAATCTCAGAGGC
CTGAAAAATAGGCCGGGCACCACACAACCTGCAGATGTGACCAACTGGATCCGTAAAAAGCCAAATTATCCTAAT
AATATTGTCATGACTTACGCATTGACGCAAAAGAAATTCTTCGCGCTTGCCAACCTCGTGAAGCAGCATCCGACT
GATGATCTTGTCTCGCAGTTGAAGACACGGAAACTCATCTCGAAGGAGCAAGTCTTGCGCGAAATGCGAAATCGC
GCAAATGACTCGGACATTGTCGCGACATCAAGTGTCATGTCACTTAAATGCCCTTTATCTACCCTCCGCATCCAA
GTACCCTGCCGCTCCATTGTTTGCACACACAACCAATGCTTTGATGCGTCTTCATTCCTTGAATTGCAAAAACAA
GCACCAACTTGGACCTGCCCTGTGTGTTCCAAATCAACTAGCTTTGAGTCTCTCCAAGTTGACCAGTACGTTGAT
GACATCCTTCAGTCAACGTCACCAGATACCGACCAAGTCATCGTTGAACCCGACGGCGTATGGTCAAGCCCCACT
GATTCCGACGCGACGAAATTGGGAGGGATGACTCCCGCGTCAGATGACGATGACGACTTGATCGAGATCAGCGAA
CCAGGGATGCCCGTTGTAAAACAGGAACCGGGACCCACGACCGTCGCCCTGGAACGAACACCTGCACAGTCACAG
TCACGAGAGGCATCCACCCCGTCCTCCGCGATGCGCATGTCCAGCAAAAAACGACCTATTGCTCAGGTCATCGAC
CTTACTGAAAGTGGTGATGAAGATGACGAGTCCCCTCTTCCACCTCCTAAAAGGCCAGCTACAAGTCTGCCATCC
CGGGCTTTTTCTCGTCAGGATTACCATGTCCCGCCCGCCAGCAGCCCTCTGAATGGCGGGTCGTACCCACCATGA
Transcript >Pro_DTO039G3_2|g6586.t1
ATGTCGACCAGCCTGTCGTCAGAGGTCGCGACACTGACAGCCTTTATCAAGCCCCTTACAAATCCACAACTGAAA
GATTTGTTGAGGTATGAGGGCCTCCAGGTATCCGGGTTGAAGGCAACCCTACAGTTTCGCATTATCCAACGAATC
CAATCTCTCGCAGAATCTGACCCTGTCAGTTTCGATGCTCTAGCTCGGCGCATCCGTGCTACTGCTTTTCCAAAC
ACCGTGCCGTATCAATCACCCGCTAGACCACAATACCAGCCACCGCCTGTCTCTCAATCTCCTGCACAGGCTCGA
TCCGCGCCGCTCGGGGTTTCCATGTCACCTCACTCATACTCTGGTCCGAGTGCTCCTCTCATGAAACCTCCTGCG
GCCGCTCATAAATCTCCAGGTCCTTTGATTTTCAAAGAAAGTCCATTTTATACAATCCTAGAGCCTTTGACTGCA
GTCGTGGAATGTAAAGTACGCGAACAAACGCGGGATAGTGTTGAACTGAAGGTCATGCTATCTCAGCAAGTTGCC
TATAGGCTGCAAACGGACTCAAATCTTCGAGTGATGGTTTATTGCGCCGGTGATTCAGGTCTCACACAATACACC
AAGTCGGATATCGCATTTCCACATCAAGTGGAGCTCAAAGTCAATCTCGATGAAGTCAAAGCTAATCTCAGAGGC
CTGAAAAATAGGCCGGGCACCACACAACCTGCAGATGTGACCAACTGGATCCGTAAAAAGCCAAATTATCCTAAT
AATATTGTCATGACTTACGCATTGACGCAAAAGAAATTCTTCGCGCTTGCCAACCTCGTGAAGCAGCATCCGACT
GATGATCTTGTCTCGCAGTTGAAGACACGGAAACTCATCTCGAAGGAGCAAGTCTTGCGCGAAATGCGAAATCGC
GCAAATGACTCGGACATTGTCGCGACATCAAGTGTCATGTCACTTAAATGCCCTTTATCTACCCTCCGCATCCAA
GTACCCTGCCGCTCCATTGTTTGCACACACAACCAATGCTTTGATGCGTCTTCATTCCTTGAATTGCAAAAACAA
GCACCAACTTGGACCTGCCCTGTGTGTTCCAAATCAACTAGCTTTGAGTCTCTCCAAGTTGACCAGTACGTTGAT
GACATCCTTCAGTCAACGTCACCAGATACCGACCAAGTCATCGTTGAACCCGACGGCGTATGGTCAAGCCCCACT
GATTCCGACGCGACGAAATTGGGAGGGATGACTCCCGCGTCAGATGACGATGACGACTTGATCGAGATCAGCGAA
CCAGGGATGCCCGTTGTAAAACAGGAACCGGGACCCACGACCGTCGCCCTGGAACGAACACCTGCACAGTCACAG
TCACGAGAGGCATCCACCCCGTCCTCCGCGATGCGCATGTCCAGCAAAAAACGACCTATTGCTCAGGTCATCGAC
CTTACTGAAAGTGGTGATGAAGATGACGAGTCCCCTCTTCCACCTCCTAAAAGGCCAGCTACAAGTCTGCCATCC
CGGGCTTTTTCTCGTCAGGATTACCATGTCCCGCCCGCCAGCAGCCCTCTGAATGGCGGGTCGTACCCACCATGA
Gene >Pro_DTO039G3_2|g6586.t1
ATGTCGACCAGCCTGTCGTCAGAGGTCGCGACACTGACAGCCTTTATCAAGCCCCTTACAAATCCACAACTGAAA
GATTTGTTGAGGTATGAGGGCCTCCAGGTATCCGGGTTGAAGGCAACCCTACAGTTTCGCATTATCCAACGTTCG
TCAACTCTCCCTAACTCTTATTATGACTTGTTCATTTGATCTTCAAATCTCTGCTTCACATCCCATTCTTGCAGC
GATCCGTACATTGACCGACGAAATAGGAATCCAATCTCTCGCAGAATCTGACCCTGTCAGTTTCGATGCTCTAGC
TCGGCGCATCCGTGCTACTGCTTTTCCAAACACCGTGCCGTATCAATCACCCGCTAGACCACAATACCAGCCACC
GCCTGTCTCTCAATCTCCTGCACAGGCTCGATCCGCGCCGCTCGGGGTTTCCATGTCACCTCACTCATACTCTGG
TCCGAGTGCTCCTCTCATGAAACCTCCTGCGGCCGCTCATAAATCTCCAGGTCCTTTGATTTTCAAAGAAAGTCC
ATTTTATACAATCCTAGAGCCTTTGACTGCAGTCGTGGAATGTAAAGGTATGTCACTATCTATCTGTGAAGCTTG
TTGAGGGTCTATGTCTAATTTTACCTAGTACGCGAACAAACGCGGGATAGTGTTGAACTGAAGGTCATGCTATCT
CAGCAAGTTGCCTATAGGCTGCAAACGGACTCAAATCTTCGAGTGATGGTTTATTGCGCCGGTGATTCAGGTCTC
ACACAATACACCAAGTCGGATATCGCATTTCCACATCAAGTGGAGCTCAAAGTCAATCTCGATGAAGTCAAAGCT
AATCTCAGAGGCCTGAAAAATAGGCCGGGCACCACACAACCTGCAGATGTGACCAACTGGATCCGTAAAAAGCCA
AATTATCCTAATAATATTGTCATGACTTACGCATTGACGCAAAAGGTTGAGCTTGTTCCCTTTATACTCGATAGA
GCATCTGTTAGGCCGGTTGACTAACTCCTGTTTGCACAGAAATTCTTCGCGCTTGCCAACCTCGTGAAGCAGCAT
CCGACTGATGATCTTGTCTCGCAGTTGAAGACACGGAAACTCATCTCGAAGGAGCAAGTCTTGCGCGAAAGTAAG
ATCCCCTCCTATTCCCTTGGGTCAGACTATGCTAATTTCGATCCTCAGTGCGAAATCGCGCAAATGACTCGGACA
TTGTCGCGACATCAAGTGTCATGTCACTTAAATGCCCTTTATCTACCCTCCGCATCCAAGTACCCTGCCGCTCCA
TTGTTTGCACACACAACCAATGCTTTGATGCGTCTTCATTCCTTGAATTGCAAAAACAAGCACCAACTTGGACCT
GCCCTGTGTGTTCCAAATCAACTAGCTTTGAGTCTCTCCAAGTTGACCAGTAAGTCTAAACCCCCTTCCTCGGCA
TATCTGTTTCTTTTCCTAACTGGTCGTATAGGTACGTTGATGACATCCTTCAGTCAACGTCACCAGATACCGACC
AAGTCATCGTTGAACCCGACGGCGTATGGTCAAGCCCCACTGATTCCGACGCGACGAAATTGGGAGGGATGACTC
CCGCGTCAGATGACGATGACGACTTGATCGAGATCAGCGAACCAGGGATGCCCGTTGTAAAACAGGAACCGGGAC
CCACGACCGTCGCCCTGGAACGAACACCTGCACAGTCACAGTCACGAGAGGCATCCACCCCGTCCTCCGCGATGC
GCATGTCCAGCAAAAAACGACCTATTGCTCAGGTCATCGACCTTACTGAAAGTGGTGATGAAGATGACGAGTCCC
CTCTTCCACCTCCTAAAAGGCCAGCTACAAGTCTGCCATCCCGGGCTTTTTCTCGTCAGGATTACCATGTCCCGC
CCGCCAGCAGCCCTCTGAATGGCGGGTCGTACCCACCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail