Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO027I6_2|g6515.t1
Gene name
Locationscaffold_015:365758..367667
Strand+
Gene length (bp)1909
Transcript length (bp)1779
Coding sequence length (bp)1779
Protein length (aa) 593

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 1.2E-64 27 340
PF05199 GMC_oxred_C GMC oxidoreductase 3.1E-34 443 584

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 15 0.999465

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA3_2 1.6E-170 26 589

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup4188
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g4755.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g6605.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g4130.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g1457.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g1397.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g7309.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g3052.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g7695.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g1243.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g2783.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g1264.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g5953.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g3687.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g6603.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g6515.t1 (this protein)
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g2703.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g2892.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g5527.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g5958.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g2620.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g2795.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g4510.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g2468.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g1781.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g685.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g482.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g3133.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g3944.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g7811.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g4627.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g6554.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g2146.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g7803.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g7356.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO027I6_2|g6515.t1
MRSLIGLALLPLAVAVPHTSQKSESTYDYIIVGGGTSGLVVANRLSEKKDTTVLVIEAGGSVYNNLNVTDTLGYG
KAFDTDIDWAYKTIDQEYAGGSPQTIRAGKALGGTSTINGMAYLRAQAAQIDAWETVGNKGWNWKTLLPYFKKGE
HLQDPAQYPFLDGSGVAFDPAYHGFTGPLKVGWSSTQLNDGLAQKLNTTYQNLDVPVQYNLDPNGGDMVGYSLYP
KTVDSELNIREDAARAYYYPYQNRNNLLVWLNTHANKITWKNGHEVTANGVEVTFSNGTTTVVKATREVILAAGA
LKSPVLLELSGIGNPNILSKYGIATKINLPTVGENLQDQMNNGLQFDSKKTYSSNKSADYVAYPSAAQLFPNSTA
LGAELLRELPAYAAQVASANGNITKARDIYRFFKIQWDLIFKSGIPVAEILLSASGTSYSSEYWGSVPFSRGSVH
LSSADPTAAAIIDPKYFMLDFDLHSQVEAARFIREIFKTEPFADMVGAETSPGLSTVAAGAEDEGWADFIKGQYR
SNFHPITTAAMLPKEIGGVVDSSLKVYGTSNVRVVDASVMPFQVCGHLQSTVYAVAERAADIIKACS*
Coding >Pro_DTO027I6_2|g6515.t1
ATGCGCAGCCTCATCGGCCTTGCACTGCTTCCACTAGCGGTTGCAGTTCCCCACACCTCACAAAAGTCAGAGTCG
ACTTACGACTACATCATTGTTGGAGGTGGCACCAGTGGCCTCGTCGTTGCAAACCGATTGTCCGAGAAAAAGGAC
ACCACTGTCCTGGTGATCGAAGCCGGCGGCTCCGTTTATAACAACCTAAATGTGACCGACACTCTCGGATACGGC
AAAGCGTTTGATACCGACATTGACTGGGCCTACAAAACGATAGACCAAGAATATGCCGGTGGTTCCCCACAAACA
ATACGTGCCGGAAAGGCACTCGGAGGAACATCGACCATCAACGGCATGGCGTACCTCCGTGCCCAGGCAGCTCAG
ATCGATGCGTGGGAGACCGTCGGAAATAAGGGCTGGAACTGGAAGACTCTGCTCCCCTACTTCAAAAAGGGCGAA
CACTTGCAAGATCCGGCACAGTACCCATTCTTGGATGGATCCGGTGTTGCTTTTGATCCGGCCTACCACGGCTTT
ACTGGACCACTGAAGGTTGGCTGGTCTTCAACACAGTTGAACGACGGCCTTGCTCAGAAATTGAACACTACCTAT
CAGAACCTTGATGTTCCTGTTCAGTACAACCTGGACCCCAATGGCGGAGATATGGTTGGATACAGCTTGTATCCC
AAGACGGTTGATTCTGAGCTCAATATCCGTGAGGATGCTGCTCGTGCCTACTATTATCCCTACCAGAACCGAAAC
AATCTCCTTGTCTGGCTCAACACACACGCCAACAAGATTACCTGGAAGAATGGCCATGAGGTCACTGCGAATGGT
GTCGAGGTCACTTTTTCCAATGGCACAACCACCGTGGTTAAGGCTACTCGTGAAGTAATCCTCGCTGCTGGAGCA
TTGAAATCTCCCGTTCTGCTCGAGCTTTCCGGCATCGGAAACCCAAACATTCTTTCCAAGTACGGAATCGCCACC
AAAATTAACCTGCCAACTGTCGGCGAAAACCTGCAGGACCAAATGAACAATGGTCTCCAGTTCGACTCGAAGAAA
ACCTACAGCAGCAACAAGAGTGCCGACTACGTCGCCTACCCCTCAGCAGCCCAGCTCTTCCCCAACTCCACAGCG
CTCGGAGCCGAGCTTCTTCGCGAGCTTCCCGCTTATGCAGCACAGGTTGCATCCGCCAATGGCAACATCACCAAA
GCCCGCGACATATACCGCTTCTTTAAGATCCAGTGGGATCTGATCTTTAAATCTGGTATCCCTGTTGCGGAGATC
CTGTTGTCGGCCTCTGGAACCTCGTATAGCAGCGAATACTGGGGGTCTGTTCCGTTCTCTCGCGGCAGCGTTCAC
CTCTCTTCCGCGGACCCCACCGCGGCGGCTATCATTGACCCCAAGTACTTCATGCTGGACTTTGATCTACATTCT
CAGGTGGAGGCGGCGCGGTTTATTCGTGAGATTTTCAAAACTGAACCATTTGCTGATATGGTTGGTGCTGAAACC
AGCCCCGGTCTTTCTACTGTTGCTGCTGGTGCTGAAGATGAGGGCTGGGCTGATTTCATCAAAGGTCAATACCGA
TCAAACTTCCACCCGATCACCACAGCTGCCATGCTTCCCAAGGAGATTGGTGGTGTTGTCGACTCGTCGCTGAAG
GTTTACGGAACCTCGAATGTTCGTGTTGTGGACGCTTCCGTCATGCCTTTCCAGGTTTGCGGTCACCTTCAGAGT
ACCGTCTATGCGGTTGCTGAGCGTGCGGCCGATATCATCAAGGCGTGCTCCTAG
Transcript >Pro_DTO027I6_2|g6515.t1
ATGCGCAGCCTCATCGGCCTTGCACTGCTTCCACTAGCGGTTGCAGTTCCCCACACCTCACAAAAGTCAGAGTCG
ACTTACGACTACATCATTGTTGGAGGTGGCACCAGTGGCCTCGTCGTTGCAAACCGATTGTCCGAGAAAAAGGAC
ACCACTGTCCTGGTGATCGAAGCCGGCGGCTCCGTTTATAACAACCTAAATGTGACCGACACTCTCGGATACGGC
AAAGCGTTTGATACCGACATTGACTGGGCCTACAAAACGATAGACCAAGAATATGCCGGTGGTTCCCCACAAACA
ATACGTGCCGGAAAGGCACTCGGAGGAACATCGACCATCAACGGCATGGCGTACCTCCGTGCCCAGGCAGCTCAG
ATCGATGCGTGGGAGACCGTCGGAAATAAGGGCTGGAACTGGAAGACTCTGCTCCCCTACTTCAAAAAGGGCGAA
CACTTGCAAGATCCGGCACAGTACCCATTCTTGGATGGATCCGGTGTTGCTTTTGATCCGGCCTACCACGGCTTT
ACTGGACCACTGAAGGTTGGCTGGTCTTCAACACAGTTGAACGACGGCCTTGCTCAGAAATTGAACACTACCTAT
CAGAACCTTGATGTTCCTGTTCAGTACAACCTGGACCCCAATGGCGGAGATATGGTTGGATACAGCTTGTATCCC
AAGACGGTTGATTCTGAGCTCAATATCCGTGAGGATGCTGCTCGTGCCTACTATTATCCCTACCAGAACCGAAAC
AATCTCCTTGTCTGGCTCAACACACACGCCAACAAGATTACCTGGAAGAATGGCCATGAGGTCACTGCGAATGGT
GTCGAGGTCACTTTTTCCAATGGCACAACCACCGTGGTTAAGGCTACTCGTGAAGTAATCCTCGCTGCTGGAGCA
TTGAAATCTCCCGTTCTGCTCGAGCTTTCCGGCATCGGAAACCCAAACATTCTTTCCAAGTACGGAATCGCCACC
AAAATTAACCTGCCAACTGTCGGCGAAAACCTGCAGGACCAAATGAACAATGGTCTCCAGTTCGACTCGAAGAAA
ACCTACAGCAGCAACAAGAGTGCCGACTACGTCGCCTACCCCTCAGCAGCCCAGCTCTTCCCCAACTCCACAGCG
CTCGGAGCCGAGCTTCTTCGCGAGCTTCCCGCTTATGCAGCACAGGTTGCATCCGCCAATGGCAACATCACCAAA
GCCCGCGACATATACCGCTTCTTTAAGATCCAGTGGGATCTGATCTTTAAATCTGGTATCCCTGTTGCGGAGATC
CTGTTGTCGGCCTCTGGAACCTCGTATAGCAGCGAATACTGGGGGTCTGTTCCGTTCTCTCGCGGCAGCGTTCAC
CTCTCTTCCGCGGACCCCACCGCGGCGGCTATCATTGACCCCAAGTACTTCATGCTGGACTTTGATCTACATTCT
CAGGTGGAGGCGGCGCGGTTTATTCGTGAGATTTTCAAAACTGAACCATTTGCTGATATGGTTGGTGCTGAAACC
AGCCCCGGTCTTTCTACTGTTGCTGCTGGTGCTGAAGATGAGGGCTGGGCTGATTTCATCAAAGGTCAATACCGA
TCAAACTTCCACCCGATCACCACAGCTGCCATGCTTCCCAAGGAGATTGGTGGTGTTGTCGACTCGTCGCTGAAG
GTTTACGGAACCTCGAATGTTCGTGTTGTGGACGCTTCCGTCATGCCTTTCCAGGTTTGCGGTCACCTTCAGAGT
ACCGTCTATGCGGTTGCTGAGCGTGCGGCCGATATCATCAAGGCGTGCTCCTAG
Gene >Pro_DTO027I6_2|g6515.t1
ATGCGCAGCCTCATCGGCCTTGCACTGCTTCCACTAGCGGTTGCAGTTCCCCACACCTCACAAAAGTCAGAGTCG
ACTTACGACTACATCATTGTTGGAGGTGGCACCAGTGGCCTCGTCGTTGCAAACCGATTGTCCGAGAAAAAGGAC
ACCACTGTCCTGGTGATCGAAGCCGGCGGCTCCGTTTATAACAACCTAAATGTGACCGACACTCTCGGATACGGC
AAAGCGTTTGATACCGACATTGACTGGGCCTACAAAACGATAGACCAAGAATATGCCGGTGGTTCCCCACAAACA
ATACGTGCCGGAAAGGCACTCGGAGGAACATCGACCATCAACGGCATGGCGTACCTCCGTGCCCAGGCAGCTCAG
ATCGATGCGTGGGAGACCGTCGGAAATAAGGGCTGGAACTGGAAGACTCTGCTCCCCTACTTCAAAAAGGGCGAA
CACTTGCAAGATCCGGCACAGTACCCATTCTTGGATGGATCCGGTGTTGCTTTTGATCCGGCCTACCACGGCTTT
ACTGGACCACTGAAGGTTGGCTGGTCTTCAACACAGTTGAACGACGGCCTTGCTCAGAAATTGAACACTACCTAT
CAGAACCTTGATGTTCCTGTTCAGTACAACCTGGACCCCAATGGCGGAGATATGGTTGGATACAGCTTGTATCCC
AAGACGGTTGATTCTGAGCTCAATATCCGTGAGGATGCTGCTCGTGCCTACTATTATCCCTACCAGAACCGAAAC
AATCTCCTTGTCTGGCTCAACACACACGCCAACAAGATTACCTGGAAGAATGGCCATGAGGTCACTGCGAATGGT
GTCGAGGTCACTTTTTCCAATGGCACAACCACCGTGGTTAAGGCTACTCGTGAAGTAATCCTCGCTGCTGGAGCA
TTGAAATCTCCCGTTCTGCTCGAGCTTTCCGGCATCGGAAACCCAAAGTAACCATAACACCTCCCCGTTCAACAT
CTTATCAAGGCTAACCAAAAATCACTCACTAGCATTCTTTCCAAGTACGGAATCGCCACCAAAATTAACCTGCCA
ACTGTCGGCGAAAACCTGCAGGACCAAATGAACAATGGTCTCCAGTTCGACTCGAAGAAAACCTACAGCAGCAAC
AAGAGTGCCGACTACGTCGCCTACCCCTCAGCAGCCCAGCTCTTCCCCAACTCCACAGCGCTCGGAGCCGAGCTT
CTTCGCGAGCTTCCCGCTTATGCAGCACAGGTTGCATCCGCCAATGGCAACATCACCAAAGCCCGCGACATATAC
CGCTTCTTTAAGATCCAGTGGGATCTGATCTTTAAATCTGGTATCCCTGTTGCGGAGATCCTGTTGTCGGCCTCT
GGAACCTCGTATAGCAGCGAATACTGGGGGTCTGTTCCGTTCTCTCGCGGCAGCGTTCACCTCTCTTCCGCGGAC
CCCACCGCGGCGGCTATCATTGACCCCAAGTACTTCATGCTGGACTTTGATCTACATTCTCAGGTGGAGGCGGCG
CGGTTTATTCGTGAGATTTTCAAAACTGAACCATTTGCTGATATGGTTGGTGCTGAAACCAGCCCCGGTCTTTCT
ACTGTTGCTGCTGGTGCTGAAGATGAGGGCTGGGCTGATTTCATCAAAGGTCAATGTACGTGTATCATTCGCGTT
TCTGGGAGATTTGTGGAGGGAATTTTATTATTAACCTTTTATTTGACTAGACCGATCAAACTTCCACCCGATCAC
CACAGCTGCCATGCTTCCCAAGGAGATTGGTGGTGTTGTCGACTCGTCGCTGAAGGTTTACGGAACCTCGAATGT
TCGTGTTGTGGACGCTTCCGTCATGCCTTTCCAGGTTTGCGGTCACCTTCAGAGTACCGTCTATGCGGTTGCTGA
GCGTGCGGCCGATATCATCAAGGCGTGCTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail