Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO027I6_2|g629.t1
Gene name
Locationscaffold_001:1717537..1722064
Strand-
Gene length (bp)4527
Transcript length (bp)4176
Coding sequence length (bp)4176
Protein length (aa) 1392

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 3.0E-30 421 629
PF01061 ABC2_membrane ABC-2 type transporter 3.3E-31 1082 1288
PF00005 ABC_tran ABC transporter 1.2E-20 115 269
PF00005 ABC_tran ABC transporter 3.5E-21 788 938
PF06422 PDR_CDR CDR ABC transporter 8.3E-23 642 726
PF06422 PDR_CDR CDR ABC transporter 1.7E-04 1346 1387

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016020 membrane Yes
GO:0005524 ATP binding Yes
GO:0042626 ATPase-coupled transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0140657 ATP-dependent activity No
GO:0110165 cellular anatomical entity No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0031224 intrinsic component of membrane No
GO:0043167 ion binding No
GO:0005215 transporter activity No
GO:0009987 cellular process No
GO:0036094 small molecule binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0005575 cellular_component No
GO:0022804 active transmembrane transporter activity No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0022857 transmembrane transporter activity No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0017076 purine nucleotide binding No
GO:0051179 localization No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0032559 adenyl ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 437 459 22
2 466 488 22
3 523 542 19
4 549 571 22
5 581 600 19
6 685 707 22
7 1135 1157 22
8 1177 1199 22
9 1214 1236 22
10 1243 1262 19
11 1364 1386 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 3 Decorating

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup4587
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g5156.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g3160.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g5219.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g8306.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g9502.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g6864.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g7988.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g8100.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g8237.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g5050.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g6254.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g6834.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g8290.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g5808.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g629.t1 (this protein)
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g6320.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g8496.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g3834.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g4548.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g8231.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g7353.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g7945.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g5329.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g8490.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g2661.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g3335.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g9576.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g7219.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g7341.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g7810.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g6086.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g4292.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g5575.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g8213.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO027I6_2|g629.t1
MVENHHSSLEEANTPVQSDGDVQKSELAEIDGPSSKSSRIAAGESIADSVRNFLEIRQGGIPGDTGVVFHKISAI
GSGTGSQDAPTVSSAAESAFGLLSPLQNRQRKQYSRPILSGFSGTIDPGEMLLVLGKPGSGCTTFLKTLSGLWDE
YKEIQGELTVDGHPLLDVMAQRPQDILFCAESDDHFPTLTVAETLRFATRARCGPEVSATKIDTMVAQLAKLVGL
ETVLNTKVGDAKIRGVSGGERRRVSLAEALATCAHLICLDNPTQGLDSSTAVEFMEMMREWTTQSRCVAAMSVYQ
ASDAIVSYFDKVLVINSGRQIFYGRVQEAKAYFEDLGFECLSTTTVADFLNVMSADPDVRRAQEGRENQVPRTAE
EFERAFSASPIYQEMQVSVQVAKERSQAHPSPLVKTSAFALPIWHQIWYCASRQFRIVTSDYSLWAVELATIVVQ
SLVLGTLFRNQQRTTNSLFIFASSLFYSVLVPALQSMAEFGNGFAQRPLILKQKRYQISRPIAYALGLVTTDVVW
KVAAICYNIPLYFLTGFQRTPGNFFTWFLIIYLEHLALSMFFRSVAIFSPNMHRAVLPVGIFFNMYVLYTGLYVP
APQMQVWLGWLRYLNPLYYAFESVMVNEFGDLSYQCSISDLVPSGPGYTDIAHQVCTVVGSQPGDRLLSGDSYIH
AQYGFKTSHLWRNVGINAALFVFFALCSGIGMEMLRTPAGQLATVFYKSSSRGIHRRDKIDNETGSVHGNDILDA
SAGQGNDANRSQASQSNALSWTSLCLDIKTRDGDQRLLNNLSGSIKSGQLKALMGVSGAGKTTLLNALAGRSTIG
TLTGTLALNSQLLPTFFRSRMGYVQQQDIHLPTQTVREALQMTARLRRPESIPLVEKNAYVEKVIEWLNMEHIAD
ALVGVPGAGLNLEQRKKVSIGVEMASKPEILFLDEPTSGLDGQSAMLIARLLRRLADSGQAILCTIHQPAAELID
QFDKLYLLSRGGNLVYDGPLGTRCHEAIEYFQSRSRPYGSEENPAEYFLEVIGAGSRNDAHMDWASLWHDSQQGK
EREKAEQSLVPAAEHSPPLEQQSLYSVPFHVQLWVVVQRTWLYYWREPDYVTSKLWMSVGNSLLNSLTYLQSPNT
ERGAYNRVFSAFMSLIVGPPLGLQVQPRFVTLRDIFVHRERESLTYHWLAFVLSAFIVELPFTFLSSLVYWLLWY
FPVGYFYAPSRAGYSFLMYELFGVFATSLAQLCASLMPNIEAAFAANGFFFMFCNTFAGTLSPKPVTPSGWRWFY
NISPLFYLGEGVTVDVLQDLPIRCEQSEVSIFYAANGTTCGQYAKDFLEIATGYLVNPTSTAECQYCRYRDGQSY
YQQYGYEFAHRHRNIGVFIGFIAFNFTMVLVMTYLTKTRRQ*
Coding >Pro_DTO027I6_2|g629.t1
ATGGTAGAAAATCATCATTCGTCTTTAGAGGAGGCAAATACACCCGTCCAGTCCGATGGTGATGTGCAGAAATCC
GAGTTGGCTGAAATTGATGGACCATCGTCGAAATCTTCACGGATTGCAGCAGGGGAATCGATTGCAGACAGCGTT
CGCAACTTCCTTGAAATACGCCAAGGTGGCATTCCCGGTGACACTGGAGTGGTCTTTCACAAGATCTCAGCCATT
GGAAGCGGAACCGGATCACAAGATGCACCCACCGTCTCATCGGCAGCCGAGTCGGCTTTTGGGCTGTTGAGTCCT
CTACAAAATCGACAAAGGAAACAGTATTCTCGACCCATTCTCAGCGGATTCTCAGGCACGATCGACCCCGGAGAA
ATGTTGTTGGTACTAGGTAAACCCGGGAGCGGGTGTACAACTTTCCTGAAGACCCTGTCGGGCCTGTGGGATGAA
TATAAGGAAATCCAGGGTGAACTCACTGTGGATGGTCACCCACTGCTAGATGTGATGGCACAGCGACCACAGGAT
ATTCTCTTCTGCGCCGAGTCTGATGACCATTTTCCCACGTTGACTGTGGCGGAGACCCTACGCTTTGCGACCAGA
GCACGATGCGGCCCCGAAGTCTCGGCCACTAAAATTGACACGATGGTTGCTCAGCTAGCCAAGCTAGTTGGTCTT
GAAACCGTCTTGAATACGAAAGTGGGAGATGCGAAGATACGAGGAGTCAGCGGCGGAGAGCGACGGCGAGTGTCT
TTGGCGGAGGCCCTGGCCACTTGTGCCCATCTGATTTGCCTGGATAATCCAACACAAGGACTGGACTCATCCACT
GCGGTCGAATTCATGGAAATGATGCGTGAGTGGACGACACAAAGTCGATGTGTGGCCGCGATGAGCGTCTACCAA
GCCAGTGATGCAATTGTCTCCTATTTTGACAAAGTCCTGGTGATCAACTCTGGCCGTCAGATCTTCTATGGCCGT
GTACAGGAAGCGAAGGCATATTTTGAAGATCTCGGGTTTGAGTGTTTATCGACCACCACCGTCGCTGACTTCCTT
AATGTGATGTCCGCTGATCCAGACGTGCGACGAGCCCAAGAAGGCAGGGAGAACCAGGTCCCACGAACGGCGGAG
GAGTTTGAGCGTGCTTTCAGTGCGAGTCCTATCTACCAGGAAATGCAAGTGTCGGTACAAGTGGCCAAGGAGCGT
TCCCAAGCCCATCCCAGTCCCCTTGTCAAAACATCGGCCTTTGCTCTCCCCATCTGGCATCAGATTTGGTACTGT
GCCAGTCGCCAATTTCGCATCGTCACCAGTGATTATAGCTTGTGGGCGGTGGAGCTCGCCACAATCGTCGTTCAA
AGTCTGGTGTTGGGCACGCTGTTCCGAAATCAGCAGCGAACGACCAATTCATTGTTCATTTTCGCGTCTTCTTTA
TTCTACTCTGTCTTAGTCCCGGCACTGCAGTCCATGGCTGAATTTGGCAATGGATTCGCTCAGCGACCGCTCATC
CTGAAGCAGAAGCGATACCAGATCTCTCGCCCGATTGCATACGCTCTCGGCTTGGTCACCACGGATGTTGTGTGG
AAGGTGGCAGCGATCTGTTACAATATCCCCCTGTACTTCCTGACCGGATTTCAGCGGACGCCCGGAAATTTCTTC
ACCTGGTTTCTGATTATCTACCTTGAGCATCTCGCCCTGTCTATGTTCTTTCGCTCGGTGGCCATATTTTCTCCC
AACATGCATCGGGCTGTGCTGCCGGTGGGGATTTTCTTTAATATGTATGTCCTCTATACGGGGCTTTACGTTCCT
GCACCACAGATGCAGGTATGGCTTGGGTGGCTGCGATATCTAAATCCCTTGTATTATGCATTCGAGTCCGTTATG
GTGAATGAATTCGGAGATCTGAGCTATCAGTGCAGTATCTCGGATCTGGTCCCATCAGGGCCAGGATATACCGAT
ATAGCCCACCAGGTCTGTACCGTGGTGGGATCTCAACCCGGGGATCGTCTTCTGTCCGGGGATTCGTACATCCAC
GCCCAGTATGGATTCAAAACCTCCCACCTCTGGCGGAATGTAGGGATTAACGCGGCCCTATTCGTTTTCTTTGCC
CTTTGTTCAGGGATCGGGATGGAGATGCTCAGAACACCCGCAGGTCAACTAGCCACAGTTTTCTACAAGAGCAGC
TCACGAGGAATTCACCGCCGCGATAAAATCGATAATGAAACAGGATCAGTCCACGGAAACGACATTTTGGACGCA
TCGGCTGGCCAAGGCAACGACGCAAATCGGTCACAAGCAAGTCAGAGTAACGCCCTTTCATGGACCAGTCTCTGT
CTTGACATCAAAACCAGAGATGGCGATCAGCGTCTGCTTAACAATCTGAGTGGCTCGATCAAGAGTGGACAACTC
AAGGCTCTAATGGGGGTCTCGGGTGCCGGGAAGACAACCCTGCTGAACGCACTGGCTGGTCGTTCCACCATTGGG
ACTCTCACAGGAACTCTGGCGCTCAATAGTCAATTGCTTCCCACGTTCTTCCGAAGTCGAATGGGCTACGTGCAA
CAGCAGGACATTCATCTTCCTACTCAGACAGTGCGCGAAGCATTGCAAATGACGGCGCGACTTCGACGCCCAGAG
TCCATCCCTCTGGTGGAAAAAAATGCCTACGTTGAAAAGGTGATTGAGTGGTTGAATATGGAGCACATTGCGGAT
GCCCTAGTTGGTGTCCCCGGGGCCGGCCTCAATCTCGAACAACGGAAGAAAGTCAGTATTGGCGTGGAGATGGCA
TCCAAACCAGAAATCCTATTCCTGGATGAACCGACCTCGGGTCTCGATGGCCAATCCGCGATGCTGATCGCTCGC
TTGCTTCGTCGTCTGGCAGACTCGGGACAGGCCATCCTGTGCACGATCCATCAACCGGCAGCAGAGCTCATCGAC
CAGTTTGACAAGTTGTATCTGCTGAGCCGCGGAGGGAACTTGGTCTATGATGGTCCTCTTGGAACTCGCTGCCAC
GAGGCAATCGAGTATTTCCAGTCTCGGAGTCGCCCCTACGGCTCAGAAGAGAACCCGGCAGAATATTTCCTGGAG
GTTATTGGGGCTGGGTCTCGAAACGACGCCCATATGGATTGGGCTAGTCTCTGGCATGACAGCCAGCAGGGCAAG
GAGCGAGAGAAGGCAGAACAAAGTCTGGTCCCTGCCGCAGAACACTCCCCACCGCTGGAGCAACAGTCCCTGTAT
TCGGTGCCGTTCCATGTCCAGCTGTGGGTGGTGGTTCAGCGAACATGGCTTTATTATTGGAGAGAACCAGATTAT
GTCACATCGAAGCTCTGGATGAGCGTCGGAAACTCCCTCCTCAACTCCCTCACCTACTTACAGTCTCCCAACACA
GAGCGAGGGGCATATAATCGGGTCTTCTCTGCTTTCATGTCTCTCATCGTGGGCCCCCCTCTAGGGCTTCAGGTG
CAACCACGCTTCGTGACCCTGCGGGATATTTTCGTCCACCGAGAGCGAGAGAGCTTGACCTATCACTGGCTAGCA
TTTGTCTTATCTGCATTCATCGTGGAACTACCCTTCACATTTCTCAGCTCGCTAGTCTATTGGTTGTTGTGGTAC
TTCCCCGTTGGCTATTTCTACGCCCCCTCGCGCGCAGGGTACAGTTTTCTCATGTATGAACTCTTTGGAGTCTTT
GCTACTAGCCTAGCCCAGCTGTGCGCATCGCTGATGCCCAACATCGAGGCAGCCTTTGCCGCCAACGGATTCTTC
TTCATGTTTTGTAACACCTTTGCGGGGACGCTTTCTCCAAAGCCAGTGACACCCTCGGGTTGGCGCTGGTTTTAC
AATATCTCTCCCCTCTTCTATTTGGGCGAGGGTGTCACCGTGGACGTGCTACAAGATTTACCCATCCGATGCGAG
CAGTCGGAGGTTTCAATCTTCTACGCGGCGAATGGCACGACCTGTGGTCAGTATGCCAAGGATTTCCTGGAAATT
GCTACGGGATATTTGGTTAATCCCACCAGCACGGCGGAGTGTCAATATTGCCGGTATCGCGACGGACAATCATAC
TACCAACAATACGGCTATGAGTTTGCTCATCGGCATCGGAACATTGGCGTTTTCATCGGGTTTATCGCGTTCAAT
TTCACGATGGTTCTGGTGATGACCTATCTTACCAAAACACGCCGCCAGTGA
Transcript >Pro_DTO027I6_2|g629.t1
ATGGTAGAAAATCATCATTCGTCTTTAGAGGAGGCAAATACACCCGTCCAGTCCGATGGTGATGTGCAGAAATCC
GAGTTGGCTGAAATTGATGGACCATCGTCGAAATCTTCACGGATTGCAGCAGGGGAATCGATTGCAGACAGCGTT
CGCAACTTCCTTGAAATACGCCAAGGTGGCATTCCCGGTGACACTGGAGTGGTCTTTCACAAGATCTCAGCCATT
GGAAGCGGAACCGGATCACAAGATGCACCCACCGTCTCATCGGCAGCCGAGTCGGCTTTTGGGCTGTTGAGTCCT
CTACAAAATCGACAAAGGAAACAGTATTCTCGACCCATTCTCAGCGGATTCTCAGGCACGATCGACCCCGGAGAA
ATGTTGTTGGTACTAGGTAAACCCGGGAGCGGGTGTACAACTTTCCTGAAGACCCTGTCGGGCCTGTGGGATGAA
TATAAGGAAATCCAGGGTGAACTCACTGTGGATGGTCACCCACTGCTAGATGTGATGGCACAGCGACCACAGGAT
ATTCTCTTCTGCGCCGAGTCTGATGACCATTTTCCCACGTTGACTGTGGCGGAGACCCTACGCTTTGCGACCAGA
GCACGATGCGGCCCCGAAGTCTCGGCCACTAAAATTGACACGATGGTTGCTCAGCTAGCCAAGCTAGTTGGTCTT
GAAACCGTCTTGAATACGAAAGTGGGAGATGCGAAGATACGAGGAGTCAGCGGCGGAGAGCGACGGCGAGTGTCT
TTGGCGGAGGCCCTGGCCACTTGTGCCCATCTGATTTGCCTGGATAATCCAACACAAGGACTGGACTCATCCACT
GCGGTCGAATTCATGGAAATGATGCGTGAGTGGACGACACAAAGTCGATGTGTGGCCGCGATGAGCGTCTACCAA
GCCAGTGATGCAATTGTCTCCTATTTTGACAAAGTCCTGGTGATCAACTCTGGCCGTCAGATCTTCTATGGCCGT
GTACAGGAAGCGAAGGCATATTTTGAAGATCTCGGGTTTGAGTGTTTATCGACCACCACCGTCGCTGACTTCCTT
AATGTGATGTCCGCTGATCCAGACGTGCGACGAGCCCAAGAAGGCAGGGAGAACCAGGTCCCACGAACGGCGGAG
GAGTTTGAGCGTGCTTTCAGTGCGAGTCCTATCTACCAGGAAATGCAAGTGTCGGTACAAGTGGCCAAGGAGCGT
TCCCAAGCCCATCCCAGTCCCCTTGTCAAAACATCGGCCTTTGCTCTCCCCATCTGGCATCAGATTTGGTACTGT
GCCAGTCGCCAATTTCGCATCGTCACCAGTGATTATAGCTTGTGGGCGGTGGAGCTCGCCACAATCGTCGTTCAA
AGTCTGGTGTTGGGCACGCTGTTCCGAAATCAGCAGCGAACGACCAATTCATTGTTCATTTTCGCGTCTTCTTTA
TTCTACTCTGTCTTAGTCCCGGCACTGCAGTCCATGGCTGAATTTGGCAATGGATTCGCTCAGCGACCGCTCATC
CTGAAGCAGAAGCGATACCAGATCTCTCGCCCGATTGCATACGCTCTCGGCTTGGTCACCACGGATGTTGTGTGG
AAGGTGGCAGCGATCTGTTACAATATCCCCCTGTACTTCCTGACCGGATTTCAGCGGACGCCCGGAAATTTCTTC
ACCTGGTTTCTGATTATCTACCTTGAGCATCTCGCCCTGTCTATGTTCTTTCGCTCGGTGGCCATATTTTCTCCC
AACATGCATCGGGCTGTGCTGCCGGTGGGGATTTTCTTTAATATGTATGTCCTCTATACGGGGCTTTACGTTCCT
GCACCACAGATGCAGGTATGGCTTGGGTGGCTGCGATATCTAAATCCCTTGTATTATGCATTCGAGTCCGTTATG
GTGAATGAATTCGGAGATCTGAGCTATCAGTGCAGTATCTCGGATCTGGTCCCATCAGGGCCAGGATATACCGAT
ATAGCCCACCAGGTCTGTACCGTGGTGGGATCTCAACCCGGGGATCGTCTTCTGTCCGGGGATTCGTACATCCAC
GCCCAGTATGGATTCAAAACCTCCCACCTCTGGCGGAATGTAGGGATTAACGCGGCCCTATTCGTTTTCTTTGCC
CTTTGTTCAGGGATCGGGATGGAGATGCTCAGAACACCCGCAGGTCAACTAGCCACAGTTTTCTACAAGAGCAGC
TCACGAGGAATTCACCGCCGCGATAAAATCGATAATGAAACAGGATCAGTCCACGGAAACGACATTTTGGACGCA
TCGGCTGGCCAAGGCAACGACGCAAATCGGTCACAAGCAAGTCAGAGTAACGCCCTTTCATGGACCAGTCTCTGT
CTTGACATCAAAACCAGAGATGGCGATCAGCGTCTGCTTAACAATCTGAGTGGCTCGATCAAGAGTGGACAACTC
AAGGCTCTAATGGGGGTCTCGGGTGCCGGGAAGACAACCCTGCTGAACGCACTGGCTGGTCGTTCCACCATTGGG
ACTCTCACAGGAACTCTGGCGCTCAATAGTCAATTGCTTCCCACGTTCTTCCGAAGTCGAATGGGCTACGTGCAA
CAGCAGGACATTCATCTTCCTACTCAGACAGTGCGCGAAGCATTGCAAATGACGGCGCGACTTCGACGCCCAGAG
TCCATCCCTCTGGTGGAAAAAAATGCCTACGTTGAAAAGGTGATTGAGTGGTTGAATATGGAGCACATTGCGGAT
GCCCTAGTTGGTGTCCCCGGGGCCGGCCTCAATCTCGAACAACGGAAGAAAGTCAGTATTGGCGTGGAGATGGCA
TCCAAACCAGAAATCCTATTCCTGGATGAACCGACCTCGGGTCTCGATGGCCAATCCGCGATGCTGATCGCTCGC
TTGCTTCGTCGTCTGGCAGACTCGGGACAGGCCATCCTGTGCACGATCCATCAACCGGCAGCAGAGCTCATCGAC
CAGTTTGACAAGTTGTATCTGCTGAGCCGCGGAGGGAACTTGGTCTATGATGGTCCTCTTGGAACTCGCTGCCAC
GAGGCAATCGAGTATTTCCAGTCTCGGAGTCGCCCCTACGGCTCAGAAGAGAACCCGGCAGAATATTTCCTGGAG
GTTATTGGGGCTGGGTCTCGAAACGACGCCCATATGGATTGGGCTAGTCTCTGGCATGACAGCCAGCAGGGCAAG
GAGCGAGAGAAGGCAGAACAAAGTCTGGTCCCTGCCGCAGAACACTCCCCACCGCTGGAGCAACAGTCCCTGTAT
TCGGTGCCGTTCCATGTCCAGCTGTGGGTGGTGGTTCAGCGAACATGGCTTTATTATTGGAGAGAACCAGATTAT
GTCACATCGAAGCTCTGGATGAGCGTCGGAAACTCCCTCCTCAACTCCCTCACCTACTTACAGTCTCCCAACACA
GAGCGAGGGGCATATAATCGGGTCTTCTCTGCTTTCATGTCTCTCATCGTGGGCCCCCCTCTAGGGCTTCAGGTG
CAACCACGCTTCGTGACCCTGCGGGATATTTTCGTCCACCGAGAGCGAGAGAGCTTGACCTATCACTGGCTAGCA
TTTGTCTTATCTGCATTCATCGTGGAACTACCCTTCACATTTCTCAGCTCGCTAGTCTATTGGTTGTTGTGGTAC
TTCCCCGTTGGCTATTTCTACGCCCCCTCGCGCGCAGGGTACAGTTTTCTCATGTATGAACTCTTTGGAGTCTTT
GCTACTAGCCTAGCCCAGCTGTGCGCATCGCTGATGCCCAACATCGAGGCAGCCTTTGCCGCCAACGGATTCTTC
TTCATGTTTTGTAACACCTTTGCGGGGACGCTTTCTCCAAAGCCAGTGACACCCTCGGGTTGGCGCTGGTTTTAC
AATATCTCTCCCCTCTTCTATTTGGGCGAGGGTGTCACCGTGGACGTGCTACAAGATTTACCCATCCGATGCGAG
CAGTCGGAGGTTTCAATCTTCTACGCGGCGAATGGCACGACCTGTGGTCAGTATGCCAAGGATTTCCTGGAAATT
GCTACGGGATATTTGGTTAATCCCACCAGCACGGCGGAGTGTCAATATTGCCGGTATCGCGACGGACAATCATAC
TACCAACAATACGGCTATGAGTTTGCTCATCGGCATCGGAACATTGGCGTTTTCATCGGGTTTATCGCGTTCAAT
TTCACGATGGTTCTGGTGATGACCTATCTTACCAAAACACGCCGCCAGTGA
Gene >Pro_DTO027I6_2|g629.t1
ATGGTAGAAAATCATCATTCGTCTTTAGAGGAGGCAAATACACCCGTCCAGTCCGATGGTGATGTGCAGAAATCC
GAGTTGGCTGAAATTGATGGACCATCGTCGAAATCTTCACGGATTGCAGCAGGGGAATCGATTGCAGACAGCGTT
CGCAACTTCCTTGAAATACGCCAAGGTGGCATTCCCGGTGACACTGGAGTGGTCTTTCACAAGATCTCAGCCATT
GGAAGCGGAACCGGAGTGAGTACATCTAATCCAACCGAAAGAATCAGGATTGACGCTTGATAGTCACAAGATGCA
CCCACCGTCTCATCGGCAGCCGAGTCGGCTTTTGGGCTGTTGAGTCCTCTACAAAATCGACAAAGGAAACAGTAT
TCTCGACCCATTCTCAGCGGATTCTCAGGCACGATCGACCCCGGAGAAATGTTGTTGGTACTAGGTAAACCCGGG
AGCGGGTGTACAACTTTCCTGAAGACCCTGTCGGGCCTGTGGGATGAATATAAGGAAATCCAGGGTGAACTCACT
GTGGATGGTCACCCACTGCTAGATGTGATGGCACAGCGACCACAGGATATTCTCTTCTGCGGTTAGTCATCGTTT
GATGTTTGTCGTTTTGAACACACACTGACCGACATGTCTTCCTTAGCCGAGTCTGATGACCATTTTCCCACGTTG
ACTGTGGCGGAGACCCTACGCTTTGCGACCAGAGCACGATGCGGCCCCGAAGTCTCGGCCACTAAAATTGACACG
ATGGTTGCTCAGCTAGCCAAGCTAGTTGGTCTTGAAACCGTCTTGAATACGAAAGTGGGAGATGCGAAGATACGA
GGAGTCAGCGGCGGAGAGCGACGGCGAGTGTCTTTGGCGGAGGCCCTGGCCACTTGTGCCCAGTAAGTGATATCT
TCTGCTCATTCAAGTACCAAACTAGCGATTCCTCGACTCACACATCCTTACAGTCTGATTTGCCTGGATAATCCA
ACACAAGGACTGGACTCATCCACTGCGGTCGAATTCATGGAAATGATGCGTGAGTGGACGACACAAAGTCGATGT
GTGGCCGCGATGAGCGTCTACCAAGCCAGTGATGCAATTGTCTCCTATTTTGACAAAGTCCTGGTGATCAACTCT
GGCCGTCAGATCTTCTATGGCCGTGTACAGGAAGCGAAGGCATATTTTGAAGATCTCGGGTTTGAGTGTTTATCG
ACCACCACCGTCGCTGACTTCCTTAATGTGATGTCCGCTGATCCAGACGTGCGACGAGCCCAAGAAGGCAGGGAG
AACCAGGTCCCACGAACGGCGGAGGAGTTTGAGCGTGCTTTCAGTGCGAGTCCTATCTACCAGGAAATGCAAGTG
TCGGTACAAGTGGCCAAGGAGCGTTCCCAAGCCCATCCCAGTCCCCTTGTCAAAACATCGGCCTTTGCTCTCCCC
ATCTGGCATCAGATTTGGTACTGTGCCAGTCGCCAATTTCGCATCGTCACCAGTGATTATAGCTTGTGGGCGGTG
GAGCTCGCCACAATCGTCGTTCAAAGTCTGGTGTTGGGCACGCTGTTCCGAAATCAGCAGCGAACGACCAATTCA
TTGTTCATTTTCGCGTCTTCTTTATTCTACTCTGTCTTAGTCCCGGCACTGCAGTCCATGGCTGAATTTGGCAAT
GGATTCGCTCAGCGACCGCTCATCCTGAAGCAGAAGCGATACCAGATCTCTCGCCCGATTGCATACGCTCTCGGC
TTGGTCACCACGGATGTTGTGTGGAAGGTGGCAGCGATCTGTTACAATATCCCCCTGTACTTCCTGACCGGATTT
CAGCGGACGCCCGGAAATTTCTTCACCTGGTTTCTGATTATCTACCTTGAGCATCTCGCCCTGTCTATGTTCTTT
CGCTCGGTGGCCATATTTTCTCCCAACATGCATCGGGCTGTGCTGCCGGTGGGGATTTTCTTTAATATGTATGTC
CTCTATACGGGGCTTTACGTTCCTGCACCACAGATGCAGGTATGGCTTGGGTGGCTGCGATATCTAAATGTCAGT
GGGTATCATATTATGGGGTTTGGACAAATGCTAACATGTGACAGCCCTTGTATTATGCATTCGAGTCCGTTATGG
TGAATGAATTCGGAGATCTGAGCTATCAGTGCAGTATCTCGGATCTGGTCCCATCAGGGCCAGGATATACCGATA
TAGCCCACCAGGTCTGTACCGTGGTGGGATCTCAACCCGGGGATCGTCTTCTGTCCGGGGATTCGTACATCCACG
CCCAGTATGGATTCAAAACCTCCCACCTCTGGCGGAATGTAGGGATTAACGCGGCCCTATTCGTTTTCTTTGCCC
TTTGTTCAGGGTAAGTTATCAGACGCTCAAGCCTAGTTCATGAGAAAAATCTACGACTGACACTGGGATTTAACA
GGATCGGGATGGAGATGCTCAGAACACCCGCAGGTCAACTAGCCACAGTTTTCTACAAGAGCAGCTCACGAGGAA
TTCACCGCCGCGATAAAATCGATAATGAAACAGGATCAGTCCACGGAAACGACATTTTGGACGCATCGGCTGGCC
AAGGCAACGACGCAAATCGGTCACAAGCAAGTCAGAGTAACGCCCTTTCATGGACCAGTCTCTGTCTTGACATCA
AAACCAGAGATGGCGATCAGCGTCTGCTTAACAATCTGAGTGGCTCGATCAAGAGTGGACAACTCAAGGCTCTAA
TGGGGGTCTCGGGTGCCGGGAAGACAACCCTGCTGAACGCACTGGCTGGTCGTTCCACCATTGGGACTCTCACAG
GAACTCTGGCGCTCAATAGTCAATTGCTTCCCACGTTCTTCCGAAGTCGAATGGGCTACGTGCAACAGCAGGACA
TTCATCTTCCTACTCAGACAGTGCGCGAAGCATTGCAAATGACGGCGCGACTTCGACGCCCAGAGTCCATCCCTC
TGGTGGAAAAAAATGCCTACGTTGAAAAGGTGATTGAGTGGTTGAATATGGAGCACATTGCGGATGCCCTAGTTG
GTGTCCCCGGGGCCGGCCTCAATCTCGAACAACGGAAGAAAGTCAGTATTGGCGTGGAGATGGCATCCAAACCAG
AAATCCTATTCCTGGATGAACCGACCTCGGGTCTCGATGGCCAATCCGCGATGCTGATCGCTCGCTTGCTTCGTC
GTCTGGCAGACTCGGGACAGGCCATCCTGTGCACGATCCATCAACCGGCAGCAGAGCTCATCGACCAGTTTGACA
AGTTGTATCTGCTGAGCCGCGGAGGGAACTTGGTCTATGATGGTCCTCTTGGAACTCGCTGCCACGAGGCAATCG
AGTATTTCCAGTCTCGGAGTCGCCCCTACGGCTCAGAAGAGAACCCGGCAGAATATTTCCTGGAGGTTATTGGGG
CTGGGTCTCGAAACGACGCCCATATGGATTGGGCTAGTCTCTGGCATGACAGCCAGCAGGGCAAGGAGCGAGAGA
AGGCAGAACAAAGTCTGGTCCCTGCCGCAGAACACTCCCCACCGCTGGAGCAACAGTCCCTGTATTCGGTGCCGT
TCCATGTCCAGCTGTGGGTGGTGGTTCAGCGAACATGGCTTTATTATTGGAGAGAACCAGATTATGTCACATCGA
AGCTCTGGATGAGCGTCGGAAACTCCCTCCTCAACTCCCTCACCTACTTACAGTCTCCCAACACAGAGCGAGGGG
CATATAATCGGGTCTTCTCTGCTTTCATGTCTCTCATCGTGGGCCCCCCTCTAGGGCTTCAGGTGCAACCACGCT
TCGTGACCCTGCGGGATATTTTCGTCCACCGAGAGCGAGAGAGCTTGACCTATCACTGGCTAGCATTTGTCTTAT
CTGCATTCATCGTGGAACTACCCTTCACATTTCTCAGCTCGCTAGTCTATTGGTTGTTGTGGTACTTCCCCGTTG
GCTATTTCTACGCCCCCTCGCGCGCAGGGTACAGTTTTCTCATGTATGAACTCTTTGGAGTCTTTGCTACTAGCC
TAGCCCAGCTGTGCGCATCGCTGATGCCCAACATCGAGGCAGCCTTTGCCGCCAACGGATTCTTCTTCATGTTTT
GTAACACCTTTGCGGGGACGCTTTCTCCAAAGCCAGTGACACCCTCGGGTTGGCGCTGGTTTTACAATATCTCTC
CCCTCTTCTATTTGGGCGAGGGTGTCACCGTGGACGTGCTACAAGATTTACCCATCCGATGCGAGCAGTCGGAGG
TTTCAATCTTCTACGCGGCGAATGGCACGACCTGTGGTCAGTATGCCAAGGATTTCCTGGAAATTGCTACGGGAT
ATTTGGTTAATCCCACCAGCACGGCGGAGTGTCAATATTGCCGGTATCGCGACGGACAATCATACGTAAGTCCTA
GTCAGGAGAGAGCAAGGAAATGGATCCGGTCTTGAAACTAATCATCAGTAGTACCAACAATACGGCTATGAGTTT
GCTCATCGGCATCGGAACATTGGCGTTTTCATCGGGTTTATCGCGTTCAATTTCACGATGGTTCTGGTGATGACC
TATCTTACCAAAACACGCCGCCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail